Report for Sequence Feature Glyma08g31000
Feature Type: gene_model
Chromosome: Gm08
Start: 26349200
stop: 26352083
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma08g31000
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT1G13380 AT
Annotation by Michelle Graham. TAIR10: Protein of unknown function (DUF1218) | chr1:4589218-4590362 REVERSE LENGTH=188
SoyBase E_val: 1.00E-91 ISS
GO:0008150 GO-bp
Annotation by Michelle Graham. GO Biological Process: biological process
SoyBase N/A ISS
GO:0005576 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: extracellular region
SoyBase N/A ISS
GO:0003674 GO-mf
Annotation by Michelle Graham. GO Molecular Function: molecular function
SoyBase N/A ISS
PF06749 PFAM
Protein of unknown function (DUF1218)
JGI ISS
UniRef100_G7JX88 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: COSII n=1 Tax=Medicago truncatula RepID=G7JX88_MEDTR
SoyBase E_val: 4.00E-120 ISS
UniRef100_UPI0001B63E27 UniRef
Annotation by Michelle Graham. Best UniRef hit: UPI0001B63E27 related cluster n=1 Tax=unknown RepID=UPI0001B63E27
SoyBase E_val: 1.00E-135 ISS
Expression Patterns of Glyma08g31000
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Gene model name correspondences to Glyma08g31000 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.08g261800 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma08g31000
Coding sequences of Glyma08g31000
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma08g31000.1 sequence type=CDS gene model=Glyma08g31000 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGGCAGAGGGAAGAGGGTCCACTCTCGTGCACCTCTTGGTCGTGGTTCTGTGCTTGGTCGCTTTCGGGTTCGCCATTGCCGCCGAGAGAAGAAGAAGCGTCGGAACCATGCACAAAATTGAAGGAACAAATGAAACATTCTGCAGCTATAGTTCAGATGTTGCCACTGGTTATGGAGTGGGCGCTTTCCTGTTTCTTCTTTCTGGTGAATCACTGCTAATGGGAGTGACAAAGTGCATGTGCTTTGGGAGGCCCTTAACACCTGGGGTAAATCGAGCGTGGTCCATTATATATTTTCTTTCTTCTTGGGTCACTTTTCTGGTAGCAGAAGCTTGCTTGATAGCAGGTGCAACCAAGAATGCCTACCACACCAAATACCGTGGAATGATTTATGCTCATAACTTCTCATGTGAAGCCTTGCGGAAAGGTGTCTTCATTGCCGGAGCGGTTTTCGTTGTTGCAACCATGATTCTTAACGTATACTATTACATGTACTTCACGAAGGCAATGACAACACCAGTTTCTCATAAGGCAAATCGGGTGAGCTCCACTGTTGGAATGGCTGGATATGCATGA
Predicted protein sequences of Glyma08g31000
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma08g31000.1 sequence type=predicted peptide gene model=Glyma08g31000 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MAEGRGSTLVHLLVVVLCLVAFGFAIAAERRRSVGTMHKIEGTNETFCSYSSDVATGYGVGAFLFLLSGESLLMGVTKCMCFGRPLTPGVNRAWSIIYFLSSWVTFLVAEACLIAGATKNAYHTKYRGMIYAHNFSCEALRKGVFIAGAVFVVATMILNVYYYMYFTKAMTTPVSHKANRVSSTVGMAGYA*