|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT4G19030 | AT | Annotation by Michelle Graham. TAIR10: NOD26-like major intrinsic protein 1 | chr4:10421728-10423409 REVERSE LENGTH=296 | SoyBase | E_val: 2.00E-29 | ISS |
| GO:0006810 | GO-bp | Annotation by Michelle Graham. GO Biological Process: transport | SoyBase | N/A | ISS |
| GO:0006833 | GO-bp | Annotation by Michelle Graham. GO Biological Process: water transport | SoyBase | N/A | ISS |
| GO:0015700 | GO-bp | Annotation by Michelle Graham. GO Biological Process: arsenite transport | SoyBase | N/A | ISS |
| GO:0031347 | GO-bp | Annotation by Michelle Graham. GO Biological Process: regulation of defense response | SoyBase | N/A | ISS |
| GO:0046685 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to arsenic-containing substance | SoyBase | N/A | ISS |
| GO:0055085 | GO-bp | Annotation by Michelle Graham. GO Biological Process: transmembrane transport | SoyBase | N/A | ISS |
| GO:0005886 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane | SoyBase | N/A | ISS |
| GO:0016020 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: membrane | SoyBase | N/A | ISS |
| GO:0016021 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: integral to membrane | SoyBase | N/A | ISS |
| GO:0005215 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: transporter activity | SoyBase | N/A | ISS |
| GO:0005515 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: protein binding | SoyBase | N/A | ISS |
| GO:0015105 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: arsenite transmembrane transporter activity | SoyBase | N/A | ISS |
| GO:0015250 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: water channel activity | SoyBase | N/A | ISS |
| PTHR19139 | Panther | AQUAPORIN TRANSPORTER | JGI | ISS | |
| PTHR19139:SF22 | Panther | gb def: glycerol uptake facilitator protein [mycoplasma pulmonis] | JGI | ISS | |
| PF00230 | PFAM | Major intrinsic protein | JGI | ISS | |
| UniRef100_G7ILK9 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Aquaporin NIP1-2 n=1 Tax=Medicago truncatula RepID=G7ILK9_MEDTR | SoyBase | E_val: 6.00E-34 | ISS |
| UniRef100_I1KWU4 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KWU4_SOYBN | SoyBase | E_val: 3.00E-60 | ISS |
|
Glyma08g29500 not represented in the dataset |
Glyma08g29500 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma.08g260700 | Wm82.a2.v1 | IGC | As supplied by JGI |
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma08g29500.1 sequence type=CDS gene model=Glyma08g29500 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGGTTGTCTTTTTTTGGTGTCTGTCATTGGTACAATTTCACATGCTCAACTTAGAAGTTATAAAGCCAATCACAGGGGCATCAATGAATCCAGCAAGAAGCTTAGGGCCTGCTATTGTGCACAATGAGTACAAAGGAATATGGATATATTTGGTGTCACCAACTCTTGGAGTTGTGGCTGGTACTTGGGCCTATAATTTCATCAGGTACACAAATAAGCCAGTGCATGAAATCACCAAGAGTGCCTCTTTCCTCAAAGGTGGTGAAGCTAAGTGA
>Glyma08g29500.1 sequence type=predicted peptide gene model=Glyma08g29500 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MVVFFWCLSLVQFHMLNLEVIKPITGASMNPARSLGPAIVHNEYKGIWIYLVSPTLGVVAGTWAYNFIRYTNKPVHEITKSASFLKGGEAK*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||