Glyma08g29500 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma08g29500): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma08g29500): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma08g29500

Feature Type:	gene_model
Chromosome:	Gm08
Start:	23981039
stop:	23981867
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma08g29500

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT4G19030	AT	Annotation by Michelle Graham. TAIR10: NOD26-like major intrinsic protein 1 \| chr4:10421728-10423409 REVERSE LENGTH=296	SoyBase	E_val: 2.00E-29	ISS
GO:0006810	GO-bp	Annotation by Michelle Graham. GO Biological Process: transport	SoyBase	N/A	ISS
GO:0006833	GO-bp	Annotation by Michelle Graham. GO Biological Process: water transport	SoyBase	N/A	ISS
GO:0015700	GO-bp	Annotation by Michelle Graham. GO Biological Process: arsenite transport	SoyBase	N/A	ISS
GO:0031347	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of defense response	SoyBase	N/A	ISS
GO:0046685	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to arsenic-containing substance	SoyBase	N/A	ISS
GO:0055085	GO-bp	Annotation by Michelle Graham. GO Biological Process: transmembrane transport	SoyBase	N/A	ISS
GO:0005886	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane	SoyBase	N/A	ISS
GO:0016020	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: membrane	SoyBase	N/A	ISS
GO:0016021	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: integral to membrane	SoyBase	N/A	ISS
GO:0005215	GO-mf	Annotation by Michelle Graham. GO Molecular Function: transporter activity	SoyBase	N/A	ISS
GO:0005515	GO-mf	Annotation by Michelle Graham. GO Molecular Function: protein binding	SoyBase	N/A	ISS
GO:0015105	GO-mf	Annotation by Michelle Graham. GO Molecular Function: arsenite transmembrane transporter activity	SoyBase	N/A	ISS
GO:0015250	GO-mf	Annotation by Michelle Graham. GO Molecular Function: water channel activity	SoyBase	N/A	ISS
PTHR19139	Panther	AQUAPORIN TRANSPORTER	JGI		ISS
PTHR19139:SF22	Panther	gb def: glycerol uptake facilitator protein [mycoplasma pulmonis]	JGI		ISS
PF00230	PFAM	Major intrinsic protein	JGI		ISS
UniRef100_G7ILK9	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Aquaporin NIP1-2 n=1 Tax=Medicago truncatula RepID=G7ILK9_MEDTR	SoyBase	E_val: 6.00E-34	ISS
UniRef100_I1KWU4	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KWU4_SOYBN	SoyBase	E_val: 3.00E-60	ISS

Expression Patterns of Glyma08g29500

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma08g29500 not represented in the dataset	Glyma08g29500 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma08g29500 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.08g260700	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma08g29500

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma08g29500

Limit To All Plant Sequences

>Glyma08g29500.1   sequence type=CDS   gene model=Glyma08g29500   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGTTGTCTTTTTTTGGTGTCTGTCATTGGTACAATTTCACATGCTCAACTTAGAAGTTATAAAGCCAATCACAGGGGCATCAATGAATCCAGCAAGAAGCTTAGGGCCTGCTATTGTGCACAATGAGTACAAAGGAATATGGATATATTTGGTGTCACCAACTCTTGGAGTTGTGGCTGGTACTTGGGCCTATAATTTCATCAGGTACACAAATAAGCCAGTGCATGAAATCACCAAGAGTGCCTCTTTCCTCAAAGGTGGTGAAGCTAAGTGA

Predicted protein sequences of Glyma08g29500

Limit To All Plant Sequences

>Glyma08g29500.1   sequence type=predicted peptide   gene model=Glyma08g29500   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MVVFFWCLSLVQFHMLNLEVIKPITGASMNPARSLGPAIVHNEYKGIWIYLVSPTLGVVAGTWAYNFIRYTNKPVHEITKSASFLKGGEAK*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain