SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma08g29090

Feature Type:gene_model
Chromosome:Gm08
Start:23486715
stop:23490024
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma08g29090
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G05850AT Annotation by Michelle Graham. TAIR10: Chitinase family protein | chr1:1766833-1768117 REVERSE LENGTH=321 SoyBaseE_val: 2.00E-173ISS
GO:0000271GO-bp Annotation by Michelle Graham. GO Biological Process: polysaccharide biosynthetic process SoyBaseN/AISS
GO:0005975GO-bp Annotation by Michelle Graham. GO Biological Process: carbohydrate metabolic process SoyBaseN/AISS
GO:0006096GO-bp Annotation by Michelle Graham. GO Biological Process: glycolysis SoyBaseN/AISS
GO:0006816GO-bp Annotation by Michelle Graham. GO Biological Process: calcium ion transport SoyBaseN/AISS
GO:0006833GO-bp Annotation by Michelle Graham. GO Biological Process: water transport SoyBaseN/AISS
GO:0006972GO-bp Annotation by Michelle Graham. GO Biological Process: hyperosmotic response SoyBaseN/AISS
GO:0007030GO-bp Annotation by Michelle Graham. GO Biological Process: Golgi organization SoyBaseN/AISS
GO:0007389GO-bp Annotation by Michelle Graham. GO Biological Process: pattern specification process SoyBaseN/AISS
GO:0008361GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of cell size SoyBaseN/AISS
GO:0009266GO-bp Annotation by Michelle Graham. GO Biological Process: response to temperature stimulus SoyBaseN/AISS
GO:0009269GO-bp Annotation by Michelle Graham. GO Biological Process: response to desiccation SoyBaseN/AISS
GO:0009408GO-bp Annotation by Michelle Graham. GO Biological Process: response to heat SoyBaseN/AISS
GO:0009409GO-bp Annotation by Michelle Graham. GO Biological Process: response to cold SoyBaseN/AISS
GO:0009414GO-bp Annotation by Michelle Graham. GO Biological Process: response to water deprivation SoyBaseN/AISS
GO:0009611GO-bp Annotation by Michelle Graham. GO Biological Process: response to wounding SoyBaseN/AISS
GO:0009651GO-bp Annotation by Michelle Graham. GO Biological Process: response to salt stress SoyBaseN/AISS
GO:0009735GO-bp Annotation by Michelle Graham. GO Biological Process: response to cytokinin stimulus SoyBaseN/AISS
GO:0009737GO-bp Annotation by Michelle Graham. GO Biological Process: response to abscisic acid stimulus SoyBaseN/AISS
GO:0009750GO-bp Annotation by Michelle Graham. GO Biological Process: response to fructose stimulus SoyBaseN/AISS
GO:0009805GO-bp Annotation by Michelle Graham. GO Biological Process: coumarin biosynthetic process SoyBaseN/AISS
GO:0009809GO-bp Annotation by Michelle Graham. GO Biological Process: lignin biosynthetic process SoyBaseN/AISS
GO:0009825GO-bp Annotation by Michelle Graham. GO Biological Process: multidimensional cell growth SoyBaseN/AISS
GO:0009926GO-bp Annotation by Michelle Graham. GO Biological Process: auxin polar transport SoyBaseN/AISS
GO:0009932GO-bp Annotation by Michelle Graham. GO Biological Process: cell tip growth SoyBaseN/AISS
GO:0010015GO-bp Annotation by Michelle Graham. GO Biological Process: root morphogenesis SoyBaseN/AISS
GO:0010053GO-bp Annotation by Michelle Graham. GO Biological Process: root epidermal cell differentiation SoyBaseN/AISS
GO:0010075GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of meristem growth SoyBaseN/AISS
GO:0010167GO-bp Annotation by Michelle Graham. GO Biological Process: response to nitrate SoyBaseN/AISS
GO:0010337GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of salicylic acid metabolic process SoyBaseN/AISS
GO:0010817GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of hormone levels SoyBaseN/AISS
GO:0016051GO-bp Annotation by Michelle Graham. GO Biological Process: carbohydrate biosynthetic process SoyBaseN/AISS
GO:0016998GO-bp Annotation by Michelle Graham. GO Biological Process: cell wall macromolecule catabolic process SoyBaseN/AISS
GO:0019344GO-bp Annotation by Michelle Graham. GO Biological Process: cysteine biosynthetic process SoyBaseN/AISS
GO:0019761GO-bp Annotation by Michelle Graham. GO Biological Process: glucosinolate biosynthetic process SoyBaseN/AISS
GO:0030243GO-bp Annotation by Michelle Graham. GO Biological Process: cellulose metabolic process SoyBaseN/AISS
GO:0030244GO-bp Annotation by Michelle Graham. GO Biological Process: cellulose biosynthetic process SoyBaseN/AISS
GO:0040007GO-bp Annotation by Michelle Graham. GO Biological Process: growth SoyBaseN/AISS
GO:0042742GO-bp Annotation by Michelle Graham. GO Biological Process: defense response to bacterium SoyBaseN/AISS
GO:0043255GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of carbohydrate biosynthetic process SoyBaseN/AISS
GO:0043481GO-bp Annotation by Michelle Graham. GO Biological Process: anthocyanin accumulation in tissues in response to UV light SoyBaseN/AISS
GO:0046686GO-bp Annotation by Michelle Graham. GO Biological Process: response to cadmium ion SoyBaseN/AISS
GO:0048765GO-bp Annotation by Michelle Graham. GO Biological Process: root hair cell differentiation SoyBaseN/AISS
GO:0048767GO-bp Annotation by Michelle Graham. GO Biological Process: root hair elongation SoyBaseN/AISS
GO:0071555GO-bp Annotation by Michelle Graham. GO Biological Process: cell wall organization SoyBaseN/AISS
GO:0005576GO-cc Annotation by Michelle Graham. GO Cellular Compartment: extracellular region SoyBaseN/AISS
GO:0005794GO-cc Annotation by Michelle Graham. GO Cellular Compartment: Golgi apparatus SoyBaseN/AISS
GO:0048046GO-cc Annotation by Michelle Graham. GO Cellular Compartment: apoplast SoyBaseN/AISS
GO:0004568GO-mf Annotation by Michelle Graham. GO Molecular Function: chitinase activity SoyBaseN/AISS
GO:0030247GO-mf Annotation by Michelle Graham. GO Molecular Function: polysaccharide binding SoyBaseN/AISS
KOG4742 KOG Predicted chitinase JGI ISS
PTHR22595Panther CHITINASE-RELATED JGI ISS
PTHR22595:SF9Panther CHITINASE JGI ISS
PF00182PFAM Chitinase class I JGI ISS
UniRef100_A2Q575UniRef Annotation by Michelle Graham. Most informative UniRef hit: Endochitinase n=1 Tax=Medicago truncatula RepID=A2Q575_MEDTR SoyBaseE_val: 0ISS
UniRef100_I1KWS8UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KWS8_SOYBN SoyBaseE_val: 0ISS

Expression Patterns of Glyma08g29090
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma08g29090
ParalogEvidenceComments
Glyma18g51980 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma08g29090 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.08g259200 Wm82.a2.v1IGC As supplied by JGI

References for Glyma08g29090
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma08g29090
>Glyma08g29090.1   sequence type=CDS   gene model=Glyma08g29090   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGATGATGGAGATGGCGAAGCGAAACGCTGTCGTTGCGGCACTCGCGGCGTTGGTGCTACTCGCGGCGAGTGTGGCGGTGGATGCTCAGGAGAACTCGGACGTGAAGACGCTGGTGAAGTACAAGCACGGGAAGAAGTACTGCGACAAAGGATGGGAATGTAAGGGCTGGTCAATTTACTGTTGTAACCTCACCATTACCGATTATTTCCAGACCTACCAGTTCGAGAATCTGTTCTCCAAGCGGAACTCGCCGGTGGCGCACGCGGTCGGATTTTGGGACTACCACTCCTTCATCGCCGCCGCCGCGCTTTTTGAGCCGGAAGGGTTCGGCACCACCGGGAACAAGACGATGCAGATGATGGAGATCGCCGCCTTCTTCGGACACGTCGGCAGCAAGACCTCTTGTGGTTATGGAGTGGCCACTGGAGGACCTTTGGCCTGGGGTCTTTGTTACAATCATGAAATGAGTCCTATGCAGTCATACTGTGATGACTACTTCAAACTCACATACCCCTGTACTCCTGGTGCTGACTACTATGGACGTGGAGCCATTCCCATTTTTTGGAACTACAACTATGGTGCTGTCGGAGAAGCTTTGAAGATTGACCTACTAAGCCATCCAGAATACATAGAGCAGAATGCCACCCTTGCTTTCCAGGCTGCAATTTGGAGATGGATGACACCAATGAAAAAGTCACAGCCCTCTGCTCATGATGCTTTTGTCGGCAGCTGGAAGCCTACCAAGAATGACACTATGGAGAATCGGGTTCCTGGATTTGGCACTACAATGAACATTCTCTATGGGGATGGTGTTTGTGGACAAGGTGATGTGGACTCAATGAACAATATTGTTTCCCATTACCTGTATTATCTTGACCTTCTTGGTGTTGGTCGAGAACAGGCTGGGCCCCATGACATCCTTACATGCGCTGAGCAGGTTCCTTTCAACCCATCTTCCAAACCTGCTTCATCATCTTAA
Predicted protein sequences of Glyma08g29090
>Glyma08g29090.1   sequence type=predicted peptide   gene model=Glyma08g29090   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MMMEMAKRNAVVAALAALVLLAASVAVDAQENSDVKTLVKYKHGKKYCDKGWECKGWSIYCCNLTITDYFQTYQFENLFSKRNSPVAHAVGFWDYHSFIAAAALFEPEGFGTTGNKTMQMMEIAAFFGHVGSKTSCGYGVATGGPLAWGLCYNHEMSPMQSYCDDYFKLTYPCTPGADYYGRGAIPIFWNYNYGAVGEALKIDLLSHPEYIEQNATLAFQAAIWRWMTPMKKSQPSAHDAFVGSWKPTKNDTMENRVPGFGTTMNILYGDGVCGQGDVDSMNNIVSHYLYYLDLLGVGREQAGPHDILTCAEQVPFNPSSKPASSS*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo