Glyma08g28900 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma08g28900

Feature Type:	gene_model
Chromosome:	Gm08
Start:	23237621
stop:	23240636
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma08g28900

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G13290	AT	Annotation by Michelle Graham. TAIR10: Protein kinase superfamily protein \| chr5:4252924-4254215 REVERSE LENGTH=401	SoyBase	E_val: 8.00E-162	ISS
GO:0006406	GO-bp	Annotation by Michelle Graham. GO Biological Process: mRNA export from nucleus	SoyBase	N/A	ISS
GO:0006468	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein phosphorylation	SoyBase	N/A	ISS
GO:0007155	GO-bp	Annotation by Michelle Graham. GO Biological Process: cell adhesion	SoyBase	N/A	ISS
GO:0009855	GO-bp	Annotation by Michelle Graham. GO Biological Process: determination of bilateral symmetry	SoyBase	N/A	ISS
GO:0009886	GO-bp	Annotation by Michelle Graham. GO Biological Process: post-embryonic morphogenesis	SoyBase	N/A	ISS
GO:0009909	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of flower development	SoyBase	N/A	ISS
GO:0009944	GO-bp	Annotation by Michelle Graham. GO Biological Process: polarity specification of adaxial/abaxial axis	SoyBase	N/A	ISS
GO:0009965	GO-bp	Annotation by Michelle Graham. GO Biological Process: leaf morphogenesis	SoyBase	N/A	ISS
GO:0010014	GO-bp	Annotation by Michelle Graham. GO Biological Process: meristem initiation	SoyBase	N/A	ISS
GO:0010073	GO-bp	Annotation by Michelle Graham. GO Biological Process: meristem maintenance	SoyBase	N/A	ISS
GO:0010074	GO-bp	Annotation by Michelle Graham. GO Biological Process: maintenance of meristem identity	SoyBase	N/A	ISS
GO:0010075	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of meristem growth	SoyBase	N/A	ISS
GO:0010082	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of root meristem growth	SoyBase	N/A	ISS
GO:0010090	GO-bp	Annotation by Michelle Graham. GO Biological Process: trichome morphogenesis	SoyBase	N/A	ISS
GO:0016570	GO-bp	Annotation by Michelle Graham. GO Biological Process: histone modification	SoyBase	N/A	ISS
GO:0045010	GO-bp	Annotation by Michelle Graham. GO Biological Process: actin nucleation	SoyBase	N/A	ISS
GO:0048449	GO-bp	Annotation by Michelle Graham. GO Biological Process: floral organ formation	SoyBase	N/A	ISS
GO:0048481	GO-bp	Annotation by Michelle Graham. GO Biological Process: ovule development	SoyBase	N/A	ISS
GO:0048507	GO-bp	Annotation by Michelle Graham. GO Biological Process: meristem development	SoyBase	N/A	ISS
GO:0048765	GO-bp	Annotation by Michelle Graham. GO Biological Process: root hair cell differentiation	SoyBase	N/A	ISS
GO:0071555	GO-bp	Annotation by Michelle Graham. GO Biological Process: cell wall organization	SoyBase	N/A	ISS
GO:0005886	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane	SoyBase	N/A	ISS
GO:0004672	GO-mf	Annotation by Michelle Graham. GO Molecular Function: protein kinase activity	SoyBase	N/A	ISS
GO:0005515	GO-mf	Annotation by Michelle Graham. GO Molecular Function: protein binding	SoyBase	N/A	ISS
GO:0005524	GO-mf	Annotation by Michelle Graham. GO Molecular Function: ATP binding	SoyBase	N/A	ISS
GO:0016301	GO-mf	Annotation by Michelle Graham. GO Molecular Function: kinase activity	SoyBase	N/A	ISS
GO:0016772	GO-mf	Annotation by Michelle Graham. GO Molecular Function: transferase activity, transferring phosphorus-containing groups	SoyBase	N/A	ISS
GO:0019900	GO-mf	Annotation by Michelle Graham. GO Molecular Function: kinase binding	SoyBase	N/A	ISS
GO:0033612	GO-mf	Annotation by Michelle Graham. GO Molecular Function: receptor serine/threonine kinase binding	SoyBase	N/A	ISS
KOG1187	KOG	Serine/threonine protein kinase	JGI		ISS
PTHR24420	Panther	FAMILY NOT NAMED	JGI		ISS
PTHR24420:SF919	Panther		JGI		ISS
PF00069	PFAM	Protein kinase domain	JGI		ISS
UniRef100_G7KSV5	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: LRR receptor-like serine/threonine-protein kinase FEI n=1 Tax=Medicago truncatula RepID=G7KSV5_MEDTR	SoyBase	E_val: 0	ISS
UniRef100_I1KWR5	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KWR5_SOYBN	SoyBase	E_val: 0	ISS

Expression Patterns of Glyma08g28900

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma08g28900

Paralog	Evidence	Comments
Glyma18g51820	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma08g28900 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.08g257700	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma08g28900

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma08g28900

Limit To All Plant Sequences

>Glyma08g28900.1   sequence type=CDS   gene model=Glyma08g28900   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTTTAGGAAAAGGCACATCCTTTCTTCTCTTGCAAGGGAATTGTTGGCACTCCAGCCACTTTTTCTTCTCTTCTTGTTCAGCTTGCACCACAACACTGTGCAGTGTCAAGGAAGGTTGAGTAAGCATGTTTCTTCAGAGCCTCCCTCACCTTCTAGGCCATCGTCAGCAGCACCATCTTCATCAGGATACAAGGATGACCCTAGGAAGATAATTTTGAGCATGGTTTTAGGAGCAGTCACTGGGCTAGTTTGTTCTGTTCTGTTTGCACTTGTGGTTCGTTGTGTTGTTCAGTATCTGAACCGCACACCAATCCTCAAGGGCCCTGTCATATTCTCCCCCAAAATTGCCTCCAAGACACTCCAATCAGCTTTGGCAAAGGAAAACCACTTGCTTGGCTCGAGTCCTAATGGGAAGTACTATAAAACTATGCTTGACAATGGACTCACTATTGCAGTCAAAAGGCTAACACCCTTTGAGAGCAATTCCCCGGAGGCCAAGAGGAAATCAGTGAAGAGGCAGATACAAACTGAGCTTGAACTTCTTGCAAGCCTTAGGAATAGGAACCTGATGAGTTTGAGAGCCTATGTTCGTGAGCCTGATGGATTCTCATTGGTTTATGATTATGCGTCCACTGGGAGTCTTGCTGATGTGTTGAATAGAGTGAGGGAGAATGAGTTGCCCTTTGGTTGGGAAGTTAGGCTCAGGATTGCTGTTGGTGTGGTGAAGGGTCTTCAGTATCTTCACTTCACTTGTGTGCCTCAGATTCTGCACTACAACTTGAAGCCCACTAATGTGATGTTGGATGCTGAGTTTGAACCTAGATTAGCAGATTATGGCTTGGCTAAACTTCTGCCTAACTTGGATAGAGGAAGTTCTCTCTACACCCCTCCTGAATGTTTCCACAATTGCAGCAGGTACACCGACAAAAGTGATATCTTCAGTTTTGGCATCATACTAGGTGTTTTATTAACCAGTAAGGACCCTACAGATCCATTCTTTGGAGAAGCAGCCAGTGGGGGAAGTTTGGGATGTTGGTTGAGACACTTGCAGCAAGCCGGTGAGTCACGTGAAGCTCTAGATAAGAGCATGTTAGGAGAAGAAGGTGAGGAAGATGAGATGCTAATGGCTGTTAGGATTGCTGCTGCATGCCTTTCTGATATGCCTGCAGATAGGCCTTCTAGTGATGAGCTTGTTCACATGCTAACGCAACTGCACAGTTTTTGA

Predicted protein sequences of Glyma08g28900

Limit To All Plant Sequences

>Glyma08g28900.1   sequence type=predicted peptide   gene model=Glyma08g28900   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MFRKRHILSSLARELLALQPLFLLFLFSLHHNTVQCQGRLSKHVSSEPPSPSRPSSAAPSSSGYKDDPRKIILSMVLGAVTGLVCSVLFALVVRCVVQYLNRTPILKGPVIFSPKIASKTLQSALAKENHLLGSSPNGKYYKTMLDNGLTIAVKRLTPFESNSPEAKRKSVKRQIQTELELLASLRNRNLMSLRAYVREPDGFSLVYDYASTGSLADVLNRVRENELPFGWEVRLRIAVGVVKGLQYLHFTCVPQILHYNLKPTNVMLDAEFEPRLADYGLAKLLPNLDRGSSLYTPPECFHNCSRYTDKSDIFSFGIILGVLLTSKDPTDPFFGEAASGGSLGCWLRHLQQAGESREALDKSMLGEEGEEDEMLMAVRIAAACLSDMPADRPSSDELVHMLTQLHSF*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain