SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma08g28411): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma08g28411): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma08g28411

Feature Type:gene_model
Chromosome:Gm08
Start:22697498
stop:22698490
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G42960AT Annotation by Michelle Graham. TAIR10: TAPETUM 1 | chr3:15018735-15019656 REVERSE LENGTH=272 SoyBaseE_val: 9.00E-76ISS
GO:0008152GO-bp Annotation by Michelle Graham. GO Biological Process: metabolic process SoyBaseN/AISS
GO:0009908GO-bp Annotation by Michelle Graham. GO Biological Process: flower development SoyBaseN/AISS
GO:0010584GO-bp Annotation by Michelle Graham. GO Biological Process: pollen exine formation SoyBaseN/AISS
GO:0005575GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cellular component SoyBaseN/AISS
GO:0000166GO-mf Annotation by Michelle Graham. GO Molecular Function: nucleotide binding SoyBaseN/AISS
GO:0016491GO-mf Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity SoyBaseN/AISS
KOG0725 KOG Reductases with broad range of substrate specificities JGI ISS
PTHR24314Panther FAMILY NOT NAMED JGI ISS
PTHR24314:SF85Panther JGI ISS
PF00106PFAM short chain dehydrogenase JGI ISS
UniRef100_B9S7B8UniRef Annotation by Michelle Graham. Most informative UniRef hit: Short chain alcohol dehydrogenase, putative n=1 Tax=Ricinus communis RepID=B9S7B8_RICCO SoyBaseE_val: 7.00E-94ISS
UniRef100_UPI0002337C4DUniRef Annotation by Michelle Graham. Best UniRef hit: UPI0002337C4D related cluster n=1 Tax=unknown RepID=UPI0002337C4D SoyBaseE_val: 9.00E-146ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma08g28411 not represented in the dataset

Glyma08g28411 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma18g51360 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.08g255600 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma08g28411.1   sequence type=CDS   gene model=Glyma08g28411   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAGCCACAACATGTGACTGATCAGAATATAGAAACTCAAAAATCATCAACAAAGGGGCTAGCTGATAAGGTGGCAGTTATAACTGGTGGTGCAAGAGGAATTGGGGCAGCTGCAGCTAAACTGTTTGCTGAAATTGGAGCACATGTGGTAATTGCTGATGTGCTTGATGATCTAGGTACCACAATGGCTGAATCCATTGGTGGCCGCTACATACACTGCAATGTGTCGAAGGAAGATGATGTTGAATCAGCCATAAACCTTGCACTATCATGGAAGGGCAATCTAGACATCATGCTCAGCAATGCAGGAATTGAAGGCCCTAAGGGAAGCGTCACAACCCTTGACATGGACCAAGTGAGGCACTTGTTCTCCATCAACCTTCATGGAATCAATCATGCTGCAAGGGCAATGATCAAAGCAATTGATGGGTTGGTGAGAAGTGGTACCTGTGAATTGGGAGAGCATTGGATTCGTGTTAACTGCATTTCCCCACATGGGGTCCCCTCTGAGATGCTTCTAAGTGCTTGTAGAAGGTTTGCTCATGGTGCAACCATTGAAGATGTGGCACATGCTGCTTTGTTTTTGGCTAGTGATGAGTCTGGCTTCATAACAACACACAATCTTCTTGTGGATGGGGGACACACCTCTGCTGATAGTAGAATGAGTTACATGTACCAAAACCTAAAATGA

>Glyma08g28411.1   sequence type=predicted peptide   gene model=Glyma08g28411   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MEPQHVTDQNIETQKSSTKGLADKVAVITGGARGIGAAAAKLFAEIGAHVVIADVLDDLGTTMAESIGGRYIHCNVSKEDDVESAINLALSWKGNLDIMLSNAGIEGPKGSVTTLDMDQVRHLFSINLHGINHAARAMIKAIDGLVRSGTCELGEHWIRVNCISPHGVPSEMLLSACRRFAHGATIEDVAHAALFLASDESGFITTHNLLVDGGHTSADSRMSYMYQNLK*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo