SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma08g28280

Feature Type:gene_model
Chromosome:Gm08
Start:22570104
stop:22570899
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma08g28280
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G31730AT Annotation by Michelle Graham. TAIR10: glutamine dumper 1 | chr4:15361207-15361683 FORWARD LENGTH=158 SoyBaseE_val: 3.00E-22ISS
GO:0010585GO-bp Annotation by Michelle Graham. GO Biological Process: glutamine secretion SoyBaseN/AISS
GO:0080143GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of amino acid export SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0016021GO-cc Annotation by Michelle Graham. GO Cellular Compartment: integral to membrane SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
UniRef100_C6THG3UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6THG3_SOYBN SoyBaseE_val: 5.00E-84ISS
UniRef100_O81775UniRef Annotation by Michelle Graham. Most informative UniRef hit: Protein GLUTAMINE DUMPER 1 n=1 Tax=Arabidopsis thaliana RepID=GDU1_ARATH SoyBaseE_val: 2.00E-19ISS

Expression Patterns of Glyma08g28280
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma08g28280
ParalogEvidenceComments
Glyma18g51280 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma08g28280 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.08g254800 Wm82.a2.v1IGC As supplied by JGI

References for Glyma08g28280
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma08g28280
>Glyma08g28280.1   sequence type=CDS   gene model=Glyma08g28280   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAGAGCAATAAAGAGTGTACCAACATCATCTCCAGTGAGTGGCAGTGGGATTAATATATGGAAGTCTCCAATTCCTTACTTGTTTGGAGGCTTAGCAGTGATGCTGGCTATCATATCTATGGCATTGGTGATCCTTGTTTGCTCCTACAGAAAACGTGATTCTCAGTCATCATCATCATCATCTGAAGTTGATCAAGAAGAAATTAAATCACAAGCAATGTCCAAGAACTTAGAGACAAACTCGGAGCCTGAGGTTCTTGTCATAATGGCTGGGAATCACAACCCCACATACCTTGCCAAACCAATCACTTCTTCTTCTTCAATTTACTGCACTTGTGGGGCTCAAACAAACCCTTCTTCATCCTCATCCACTGAGTGA
Predicted protein sequences of Glyma08g28280
>Glyma08g28280.1   sequence type=predicted peptide   gene model=Glyma08g28280   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MRAIKSVPTSSPVSGSGINIWKSPIPYLFGGLAVMLAIISMALVILVCSYRKRDSQSSSSSSEVDQEEIKSQAMSKNLETNSEPEVLVIMAGNHNPTYLAKPITSSSSIYCTCGAQTNPSSSSSTE*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo