SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma08g27986): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma08g27986): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma08g27986

Feature Type:gene_model
Chromosome:Gm08
Start:22226270
stop:22228200
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G02260AT Annotation by Michelle Graham. TAIR10: auxin transport protein (BIG) | chr3:431152-448489 REVERSE LENGTH=5098 SoyBaseE_val: 1.00E-16ISS
GO:0009620GO-bp Annotation by Michelle Graham. GO Biological Process: response to fungus SoyBaseN/AISS
GO:0009640GO-bp Annotation by Michelle Graham. GO Biological Process: photomorphogenesis SoyBaseN/AISS
GO:0009733GO-bp Annotation by Michelle Graham. GO Biological Process: response to auxin stimulus SoyBaseN/AISS
GO:0009826GO-bp Annotation by Michelle Graham. GO Biological Process: unidimensional cell growth SoyBaseN/AISS
GO:0009926GO-bp Annotation by Michelle Graham. GO Biological Process: auxin polar transport SoyBaseN/AISS
GO:0010311GO-bp Annotation by Michelle Graham. GO Biological Process: lateral root formation SoyBaseN/AISS
GO:0048281GO-bp Annotation by Michelle Graham. GO Biological Process: inflorescence morphogenesis SoyBaseN/AISS
GO:0048283GO-bp Annotation by Michelle Graham. GO Biological Process: indeterminate inflorescence morphogenesis SoyBaseN/AISS
GO:0048364GO-bp Annotation by Michelle Graham. GO Biological Process: root development SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0009506GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasmodesma SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0004842GO-mf Annotation by Michelle Graham. GO Molecular Function: ubiquitin-protein ligase activity SoyBaseN/AISS
GO:0008270GO-mf Annotation by Michelle Graham. GO Molecular Function: zinc ion binding SoyBaseN/AISS
UniRef100_G7KRX3UniRef Annotation by Michelle Graham. Most informative UniRef hit: E3 ubiquitin-protein ligase UBR4 n=1 Tax=Medicago truncatula RepID=G7KRX3_MEDTR SoyBaseE_val: 2.00E-57ISS
UniRef100_UPI000233D9EDUniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233D9ED related cluster n=1 Tax=unknown RepID=UPI000233D9ED SoyBaseE_val: 1.00E-96ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma08g27986 not represented in the dataset

Glyma08g27986 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma08g27986.1   sequence type=CDS   gene model=Glyma08g27986   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCCGCCGATAGCCTCGCCGTCCTCGCCGAGGCTCTGTCGCCGCCGGTCTCGCCCGGCGACTTTCTATCCAAGCTCCGCTCCGACGACGCCGTCCTGTTAGGTCTCAACGCGTTCTGCTCCGTTCTCCGCCGCGGTCTCCAATCCTCTGATGACGGAACCTCGCTCTTCCTATCCTGGACCGACGCGCAGATTCATGCGATTTCCTCGCTTGCCCACGCAATCGCCTCCGCTTCTCGATCTTTGTCAGTGGAGCAAGCGGAGGGGGTGCTGGTTGCGATTGTGCAACAGTCTATAGAATTTGCTCTGTGCTATTTGGAGAATTCTGGAGTCACTAGTGACGATCTAGGAATTCAGAACAACATGATACATCTTTTAGAGATGGCTTTGGTTGATGGAATAAATATGGTAGCGGACATATTGCAACCTACAACTGCTAGTGCCTTGATAGATATGTTGCCAATGGTTGATGATTGTTGTGGTAGTTTTGTGGATGACTACAAAAAATGCCATCTAGAA

>Glyma08g27986.1   sequence type=predicted peptide   gene model=Glyma08g27986   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAADSLAVLAEALSPPVSPGDFLSKLRSDDAVLLGLNAFCSVLRRGLQSSDDGTSLFLSWTDAQIHAISSLAHAIASASRSLSVEQAEGVLVAIVQQSIEFALCYLENSGVTSDDLGIQNNMIHLLEMALVDGINMVADILQPTTASALIDMLPMVDDCCGSFVDDYKKCHLE







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo