SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma08g27830

Feature Type:gene_model
Chromosome:Gm08
Start:22114966
stop:22115836
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma08g27830.1   sequence type=CDS   gene model=Glyma08g27830   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
GTTCCTGTGATCCAGTATGTAGATTTTCTGCTTCAAAATATCAAGAGTACTTCACTGTTTCAAATCTTGAAGCTTTTGTATTACAACCATCGCCTCAGGATCCTTTCTATGTTATTTAATTTGAAGTTTTTGATGGGGAAATTTTATCAGGTTATGTCTATTCATCATTCAAATTTCAACAGTGTCTTTTTTAGTAAGACGTACACTAAAATGGGGGTTATAGAGAACTTAGGCGACTAG

>Glyma08g27830.1   sequence type=predicted peptide   gene model=Glyma08g27830   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
VPVIQYVDFLLQNIKSTSLFQILKLLYYNHRLRILSMLFNLKFLMGKFYQVMSIHHSNFNSVFFSKTYTKMGVIENLGD*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo