SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma08g27794

Feature Type:gene_model
Chromosome:Gm08
Start:22109698
stop:22110722
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma08g27794
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G47790AT Annotation by Michelle Graham. TAIR10: F-box and associated interaction domains-containing protein | chr1:17600004-17601173 REVERSE LENGTH=389 SoyBaseE_val: 3.00E-12ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
PF00646PFAM F-box domain JGI ISS
UniRef100_C6TNU0UniRef Annotation by Michelle Graham. Best UniRef hit: Putative uncharacterized protein n=1 Tax=Glycine max RepID=C6TNU0_SOYBN SoyBaseE_val: 6.00E-63ISS
UniRef100_G7IX76UniRef Annotation by Michelle Graham. Most informative UniRef hit: F-box n=1 Tax=Medicago truncatula RepID=G7IX76_MEDTR SoyBaseE_val: 8.00E-14ISS

Expression Patterns of Glyma08g27794
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma08g27794 not represented in the dataset
Glyma08g27794 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma08g27794 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.08g251700 Wm82.a2.v1IGC As supplied by JGI

References for Glyma08g27794
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma08g27794
>Glyma08g27794.1   sequence type=CDS   gene model=Glyma08g27794   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAACCCCACTTTCTCTCATGACTTGATAGTAGAAATTTTATTGAGATTGCCAATCAAATCTCTCTTGCGTTTCAAATGTGTTTGTAAATCATGGCTTTCCTTCATTTCCGATCCTCATTTTGTAAAATCTCACTTAGTTGTTGCACCCACCAATCAAACTCTTCTTGATTATGATTTCTCCATCTGCCCTAACCCTAGTGGTATGCATATTTGGGGAATCAAGTTTTTCTCCTGCAAAACCAATTCAGAGGGAAGAAAGTTGAGGGTAACTTTGGGTATACATTGA
Predicted protein sequences of Glyma08g27794
>Glyma08g27794.1   sequence type=predicted peptide   gene model=Glyma08g27794   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MNPTFSHDLIVEILLRLPIKSLLRFKCVCKSWLSFISDPHFVKSHLVVAPTNQTLLDYDFSICPNPSGMHIWGIKFFSCKTNSEGRKLRVTLGIH*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo