SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma08g27633): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma08g27633): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma08g27633

Feature Type:gene_model
Chromosome:Gm08
Start:21938713
stop:21952487
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G24530AT Annotation by Michelle Graham. TAIR10: 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein | chr5:8378964-8383154 FORWARD LENGTH=341 SoyBaseE_val: 5.00E-48ISS
GO:0000165GO-bp Annotation by Michelle Graham. GO Biological Process: MAPK cascade SoyBaseN/AISS
GO:0001666GO-bp Annotation by Michelle Graham. GO Biological Process: response to hypoxia SoyBaseN/AISS
GO:0006612GO-bp Annotation by Michelle Graham. GO Biological Process: protein targeting to membrane SoyBaseN/AISS
GO:0009595GO-bp Annotation by Michelle Graham. GO Biological Process: detection of biotic stimulus SoyBaseN/AISS
GO:0009617GO-bp Annotation by Michelle Graham. GO Biological Process: response to bacterium SoyBaseN/AISS
GO:0009620GO-bp Annotation by Michelle Graham. GO Biological Process: response to fungus SoyBaseN/AISS
GO:0009627GO-bp Annotation by Michelle Graham. GO Biological Process: systemic acquired resistance SoyBaseN/AISS
GO:0009697GO-bp Annotation by Michelle Graham. GO Biological Process: salicylic acid biosynthetic process SoyBaseN/AISS
GO:0009813GO-bp Annotation by Michelle Graham. GO Biological Process: flavonoid biosynthetic process SoyBaseN/AISS
GO:0009862GO-bp Annotation by Michelle Graham. GO Biological Process: systemic acquired resistance, salicylic acid mediated signaling pathway SoyBaseN/AISS
GO:0009867GO-bp Annotation by Michelle Graham. GO Biological Process: jasmonic acid mediated signaling pathway SoyBaseN/AISS
GO:0010200GO-bp Annotation by Michelle Graham. GO Biological Process: response to chitin SoyBaseN/AISS
GO:0010310GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of hydrogen peroxide metabolic process SoyBaseN/AISS
GO:0010363GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of plant-type hypersensitive response SoyBaseN/AISS
GO:0031347GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of defense response SoyBaseN/AISS
GO:0031348GO-bp Annotation by Michelle Graham. GO Biological Process: negative regulation of defense response SoyBaseN/AISS
GO:0034976GO-bp Annotation by Michelle Graham. GO Biological Process: response to endoplasmic reticulum stress SoyBaseN/AISS
GO:0042742GO-bp Annotation by Michelle Graham. GO Biological Process: defense response to bacterium SoyBaseN/AISS
GO:0043900GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of multi-organism process SoyBaseN/AISS
GO:0045087GO-bp Annotation by Michelle Graham. GO Biological Process: innate immune response SoyBaseN/AISS
GO:0050832GO-bp Annotation by Michelle Graham. GO Biological Process: defense response to fungus SoyBaseN/AISS
GO:0055114GO-bp Annotation by Michelle Graham. GO Biological Process: oxidation-reduction process SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0016491GO-mf Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity SoyBaseN/AISS
GO:0016706GO-mf Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, 2-oxoglutarate as one donor, and incorporation of one atom each of oxygen into both donors SoyBaseN/AISS
KOG0143 KOG Iron/ascorbate family oxidoreductases JGI ISS
PTHR10209Panther FE(II)/ ASCORBATE OXIDASE SUPERFAMILY JGI ISS
PTHR10209:SF55Panther OXIDOREDUCTASE, 2OG-FE(II) OXYGENASE FAMILY PROTEI JGI ISS
UniRef100_B9T297UniRef Annotation by Michelle Graham. Most informative UniRef hit: 1-aminocyclopropane-1-carboxylate oxidase, putative n=1 Tax=Ricinus communis RepID=B9T297_RICCO SoyBaseE_val: 1.00E-76ISS
UniRef100_I3SDT9UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Medicago truncatula RepID=I3SDT9_MEDTR SoyBaseE_val: 3.00E-122ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma08g27633 not represented in the dataset

Glyma08g27633 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.08g250400 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma08g27633.1   sequence type=CDS   gene model=Glyma08g27633   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGATCGGAGTGGTTGGTATAATCTTGATTCTTTGGTGACATCATCATATGTGCAACCACCAGAAAGAAGACCCGGCAATGCTATTTTGGCCTCTGGCAAGTTAGTTCCAGTTATTGATCTTGGAGGACATGATCGAGCTGTTACCATAAAGAACATTTTGAACTCCTCCCAGGATTATGTCTTTTTCCAGGTTATCAACCATGGAGTTTCTAAGGATTTAGTGGATTCTACACAGAATATTTTCAAAGAATTCCATGCCATGCCTGCGGATGTAAAGATACATGAAAGCCCTAAGGATCCAAATGGAAGCTGCAAGATCTATACAAGTAGTGCAAGAACCACCAAAGACGTGGTTGAATATTGGAAAGACACATTATCACACCCATGTCAACCTTCTGGAGAATTCAAGGATTATTGGCCCGAGAAACCTGTTGGATACCGTGAAGTTGTAGGGAAATACACACAAGAACTAAGGAAACTGGCACTTCAAATTTTGGAGCTGATTTGTGAAGGATTTGATCTCAACCCAGAATATTTTTGTGGAGGACTTGGTGAAAATCCAGTAGTGCTGTCTCATTTCTACCCTCCTTGTCTTGAACCAAGTTTAACCTTAGGAACATTCATGCACAAAGAATCTATCCTTATTACCATTTTGTTTCAAGAAGTAGGGATCAATGCACTGCAGGTCTTCAAAGATGGGAATGGATTGATTCATATGCAGAACTATTCAAATGGAAGACTCATTGCTGCTAAACACCTGGTTATCACAAATTCAAGCAATACGAGACACAATGTTGTCTATTTCGTTAACCCAACAAAAGAATCCCTTATAGAACCTGCAAAGCCTCTGATAAGTTTAACATCTCCAGTTTATCATCATTAA

>Glyma08g27633.1   sequence type=predicted peptide   gene model=Glyma08g27633   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MDRSGWYNLDSLVTSSYVQPPERRPGNAILASGKLVPVIDLGGHDRAVTIKNILNSSQDYVFFQVINHGVSKDLVDSTQNIFKEFHAMPADVKIHESPKDPNGSCKIYTSSARTTKDVVEYWKDTLSHPCQPSGEFKDYWPEKPVGYREVVGKYTQELRKLALQILELICEGFDLNPEYFCGGLGENPVVLSHFYPPCLEPSLTLGTFMHKESILITILFQEVGINALQVFKDGNGLIHMQNYSNGRLIAAKHLVITNSSNTRHNVVYFVNPTKESLIEPAKPLISLTSPVYHH*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo