SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma08g27060): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma08g27060): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma08g27060

Feature Type:gene_model
Chromosome:Gm08
Start:21402660
stop:21402893
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma08g27060
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G20740AT Annotation by Michelle Graham. TAIR10: Transducin/WD40 repeat-like superfamily protein | chr3:7249064-7252254 REVERSE LENGTH=369 SoyBaseE_val: 4.00E-23ISS
GO:0000003GO-bp Annotation by Michelle Graham. GO Biological Process: reproduction SoyBaseN/AISS
GO:0006349GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of gene expression by genetic imprinting SoyBaseN/AISS
GO:0009409GO-bp Annotation by Michelle Graham. GO Biological Process: response to cold SoyBaseN/AISS
GO:0009910GO-bp Annotation by Michelle Graham. GO Biological Process: negative regulation of flower development SoyBaseN/AISS
GO:0010048GO-bp Annotation by Michelle Graham. GO Biological Process: vernalization response SoyBaseN/AISS
GO:0016571GO-bp Annotation by Michelle Graham. GO Biological Process: histone methylation SoyBaseN/AISS
GO:2000014GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of endosperm development SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005834GO-cc Annotation by Michelle Graham. GO Cellular Compartment: heterotrimeric G-protein complex SoyBaseN/AISS
GO:0043078GO-cc Annotation by Michelle Graham. GO Cellular Compartment: polar nucleus SoyBaseN/AISS
GO:0080008GO-cc Annotation by Michelle Graham. GO Cellular Compartment: CUL4-RING ubiquitin ligase complex SoyBaseN/AISS
GO:0000166GO-mf Annotation by Michelle Graham. GO Molecular Function: nucleotide binding SoyBaseN/AISS
GO:0003700GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
PTHR10253Panther WD-40 REPEAT PROTEIN JGI ISS
PTHR10253:SF2Panther WAIT-1 HOMOLOGUE JGI ISS
UniRef100_A8VFL1UniRef Annotation by Michelle Graham. Most informative UniRef hit: FIE n=1 Tax=Glycine max RepID=A8VFL1_SOYBN SoyBaseE_val: 2.00E-24ISS
UniRef100_I1JFF5UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JFF5_SOYBN SoyBaseE_val: 1.00E-24ISS

Expression Patterns of Glyma08g27060
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma08g27060 not represented in the dataset
Glyma08g27060 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma08g27060 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments

References for Glyma08g27060
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma08g27060
>Glyma08g27060.1   sequence type=CDS   gene model=Glyma08g27060   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
GAGTTCTGGACATATGTAGAAAAATCATTTACATGGACAGATCTTCCTTCTAAGTTTCCCATAAAATATGTCCCGTTTCCTGTATACAATGCTTCAGTTCATTTAAATTATGTTGACTGTAATAGGTGGCTAGGTCATTGTATCCTCTCAAAG
Predicted protein sequences of Glyma08g27060
>Glyma08g27060.1   sequence type=predicted peptide   gene model=Glyma08g27060   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
EFWTYVEKSFTWTDLPSKFPIKYVPFPVYNASVHLNYVDCNRWLGHCILSK






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo