Glyma08g26995 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma08g26995): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma08g26995): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma08g26995

Feature Type:	gene_model
Chromosome:	Gm08
Start:	21332183
stop:	21339052
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma08g26995

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G25940	AT	Annotation by Michelle Graham. TAIR10: TFIIB zinc-binding protein \| chr3:9495104-9495942 FORWARD LENGTH=119	SoyBase	E_val: 4.00E-17	ISS
GO:0006351	GO-bp	Annotation by Michelle Graham. GO Biological Process: transcription, DNA-dependent	SoyBase	N/A	ISS
GO:0006354	GO-bp	Annotation by Michelle Graham. GO Biological Process: DNA-dependent transcription, elongation	SoyBase	N/A	ISS
GO:0006355	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0003676	GO-mf	Annotation by Michelle Graham. GO Molecular Function: nucleic acid binding	SoyBase	N/A	ISS
GO:0003677	GO-mf	Annotation by Michelle Graham. GO Molecular Function: DNA binding	SoyBase	N/A	ISS
GO:0003700	GO-mf	Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity	SoyBase	N/A	ISS
GO:0008270	GO-mf	Annotation by Michelle Graham. GO Molecular Function: zinc ion binding	SoyBase	N/A	ISS
PTHR11239	Panther	DNA-DIRECTED RNA POLYMERASE	JGI		ISS
PF01096	PFAM	Transcription factor S-II (TFIIS)	JGI		ISS
UniRef100_C6T4H3	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: DNA-directed RNA polymerase subunit n=1 Tax=Glycine max RepID=C6T4H3_SOYBN	SoyBase	E_val: 2.00E-37	ISS
UniRef100_UPI00023390C5	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI00023390C5 related cluster n=1 Tax=unknown RepID=UPI00023390C5	SoyBase	E_val: 5.00E-39	ISS

Expression Patterns of Glyma08g26995

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma08g26995 not represented in the dataset	Glyma08g26995 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma08g26995 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.08g246200	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma08g26995

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma08g26995

Limit To All Plant Sequences

>Glyma08g26995.1   sequence type=CDS   gene model=Glyma08g26995   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTTATCCTCTGCTTGGCAGGATACCAGAAGAGAGCTTGGAATGGAAATAATTGAGGAACATACGGTGATGGAATATTCTAAGGTTAGCAAGAAATGTGAAAAATGTGGCCATGGGGAAGCTACCTATTATACTAGACAGATGAGATCAGCAGACAAAGGGCAAACTACTTTTTACACATGTACCGGTTGTGGTCATCAGTCTCAGGAGAATTAG

Predicted protein sequences of Glyma08g26995

Limit To All Plant Sequences

>Glyma08g26995.1   sequence type=predicted peptide   gene model=Glyma08g26995   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MLSSAWQDTRRELGMEIIEEHTVMEYSKVSKKCEKCGHGEATYYTRQMRSADKGQTTFYTCTGCGHQSQEN*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain