SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma08g26961

Feature Type:gene_model
Chromosome:Gm08
Start:21288033
stop:21291051
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma08g26961
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G46180AT Annotation by Michelle Graham. TAIR10: ornithine-delta-aminotransferase | chr5:18718766-18721271 REVERSE LENGTH=475 SoyBaseE_val: 4.00E-65ISS
GO:0006561GO-bp Annotation by Michelle Graham. GO Biological Process: proline biosynthetic process SoyBaseN/AISS
GO:0006593GO-bp Annotation by Michelle Graham. GO Biological Process: ornithine catabolic process SoyBaseN/AISS
GO:0006635GO-bp Annotation by Michelle Graham. GO Biological Process: fatty acid beta-oxidation SoyBaseN/AISS
GO:0007031GO-bp Annotation by Michelle Graham. GO Biological Process: peroxisome organization SoyBaseN/AISS
GO:0009626GO-bp Annotation by Michelle Graham. GO Biological Process: plant-type hypersensitive response SoyBaseN/AISS
GO:0009651GO-bp Annotation by Michelle Graham. GO Biological Process: response to salt stress SoyBaseN/AISS
GO:0009816GO-bp Annotation by Michelle Graham. GO Biological Process: defense response to bacterium, incompatible interaction SoyBaseN/AISS
GO:0010260GO-bp Annotation by Michelle Graham. GO Biological Process: organ senescence SoyBaseN/AISS
GO:0019544GO-bp Annotation by Michelle Graham. GO Biological Process: arginine catabolic process to glutamate SoyBaseN/AISS
GO:0042538GO-bp Annotation by Michelle Graham. GO Biological Process: hyperosmotic salinity response SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
GO:0004587GO-mf Annotation by Michelle Graham. GO Molecular Function: ornithine-oxo-acid transaminase activity SoyBaseN/AISS
GO:0008270GO-mf Annotation by Michelle Graham. GO Molecular Function: zinc ion binding SoyBaseN/AISS
PTHR11986Panther AMINOTRANSFERASE CLASS III JGI ISS
PTHR11986:SF18Panther AMINOTRANSFERASE JGI ISS
PF00202PFAM Aminotransferase class-III JGI ISS
UniRef100_I1K3G2UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1K3G2_SOYBN SoyBaseE_val: 4.00E-88ISS
UniRef100_Q38IW9UniRef Annotation by Michelle Graham. Most informative UniRef hit: Ornithine aminotransferase n=1 Tax=Glycine max RepID=Q38IW9_SOYBN SoyBaseE_val: 5.00E-87ISS

Expression Patterns of Glyma08g26961
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma08g26961 not represented in the dataset
Glyma08g26961 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma08g26961 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.08g245800 Wm82.a2.v1IGC As supplied by JGI

References for Glyma08g26961
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma08g26961
>Glyma08g26961.1   sequence type=CDS   gene model=Glyma08g26961   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCATAACTGTTTTAATTGTCTTTTTACTCAGATACTAGGGAAAGCATTGGGTGGAGGAGTTATACCAGTTAGTGCAGTTCTTGCAAACAAAGATGTGATGCTTTGTATACAACCGGGACAGCATGGAAGTACCTTCGGTGGAAATCCACTGGCCAGTGCAGTTGCAATTGCCTCACTAGAAGTGATAAAAATTGAGAGACTCGTTGAGAGATCTGCCCAAATGGGAGAGGAGCTTGCTGGTCAGCTGCTTAAGATTCAGCAGCAATATCCAGACTACGTGAAGGAGGTACGGGGAAGAGGATTGTTCATTGGAGTGGAGTTTAACAGCAAAAATTTGTTCCCTGTATCTGGCTATGAGGTATGCAAAAAATTAAAGTATAGAGGAGTCCTTGCCAAGCCAACACATGATACAATTATACGCTTTACTCCCCCACTTTGCATAAGGTAA
Predicted protein sequences of Glyma08g26961
>Glyma08g26961.1   sequence type=predicted peptide   gene model=Glyma08g26961   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MHNCFNCLFTQILGKALGGGVIPVSAVLANKDVMLCIQPGQHGSTFGGNPLASAVAIASLEVIKIERLVERSAQMGEELAGQLLKIQQQYPDYVKEVRGRGLFIGVEFNSKNLFPVSGYEVCKKLKYRGVLAKPTHDTIIRFTPPLCIR*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo