Glyma08g26766 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma08g26766): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma08g26766): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma08g26766

Feature Type:	gene_model
Chromosome:	Gm08
Start:	21071885
stop:	21073364
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma08g26766

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G33110	AT	Annotation by Michelle Graham. TAIR10: MATE efflux family protein \| chr1:12005084-12008040 FORWARD LENGTH=404	SoyBase	E_val: 1.00E-52	ISS
GO:0006855	GO-bp	Annotation by Michelle Graham. GO Biological Process: drug transmembrane transport	SoyBase	N/A	ISS
GO:0009610	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to symbiotic fungus	SoyBase	N/A	ISS
GO:0019344	GO-bp	Annotation by Michelle Graham. GO Biological Process: cysteine biosynthetic process	SoyBase	N/A	ISS
GO:0055085	GO-bp	Annotation by Michelle Graham. GO Biological Process: transmembrane transport	SoyBase	N/A	ISS
GO:0005886	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane	SoyBase	N/A	ISS
GO:0016020	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: membrane	SoyBase	N/A	ISS
GO:0005215	GO-mf	Annotation by Michelle Graham. GO Molecular Function: transporter activity	SoyBase	N/A	ISS
GO:0015238	GO-mf	Annotation by Michelle Graham. GO Molecular Function: drug transmembrane transporter activity	SoyBase	N/A	ISS
GO:0015297	GO-mf	Annotation by Michelle Graham. GO Molecular Function: antiporter activity	SoyBase	N/A	ISS
PTHR11206	Panther	MULTIDRUG RESISTANCE PUMP	JGI		ISS
PTHR11206:SF9	Panther	MULTI ANTIMICROBIAL EXTRUSION (MATE) FAMILY TRANSPORTER-RELATED	JGI		ISS
PF01554	PFAM	MatE	JGI		ISS
PF04646	PFAM	Protein of unknown function, DUF604	JGI		ISS
UniRef100_G7L2P1	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Protein TRANSPARENT TESTA n=2 Tax=Medicago truncatula RepID=G7L2P1_MEDTR	SoyBase	E_val: 5.00E-73	ISS
UniRef100_I1JK42	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JK42_SOYBN	SoyBase	E_val: 9.00E-88	ISS

Expression Patterns of Glyma08g26766

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma08g26766 not represented in the dataset	Glyma08g26766 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma08g26766 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.08g244400	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma08g26766

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma08g26766

Limit To All Plant Sequences

>Glyma08g26766.1   sequence type=CDS   gene model=Glyma08g26766   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCCTATGGCGGAGGAGGTTTTGCAATTAGTTATCCTCTTGCGAAGGCTCTTCACATAATATCATGGATAGTTTTATTCTTAACTGCAATATGTCTTCTTCCGTTGTTCATCTTCACAAGCCCAATTTTGACTCTCTTAGGCCAAGATGAGAGCATAACAGAAGTGGCAAGAACCATTTGTATTTGCTCAATTCCTATCTTATTTTCTTATATTGTCTCAAACAACTGCCAGACATTCCTTCAATCTCAAAGCAATAATGTCATTATTTCATTTTTGGCAGCTTTATCAATAATCATTCACGTGTCCCTCTCCTGGCTATTCACCATGCAATTCAAGTATGGGATTCCTAGGGCAATGATTTCAACAATTTTGGCATACTGGATTCCCAATATTGGTCAACTGATATTTATTACATGTGATTGGTGCCCTGAAACATGGAAAGGTTTCTCTTTTTTAGCATTCAAAGATCTTTGGCCTGCTTCCAAGCTTTCCATTTCATTTGGTGCCATGTTATCGTGA

Predicted protein sequences of Glyma08g26766

Limit To All Plant Sequences

>Glyma08g26766.1   sequence type=predicted peptide   gene model=Glyma08g26766   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAYGGGGFAISYPLAKALHIISWIVLFLTAICLLPLFIFTSPILTLLGQDESITEVARTICICSIPILFSYIVSNNCQTFLQSQSNNVIISFLAALSIIIHVSLSWLFTMQFKYGIPRAMISTILAYWIPNIGQLIFITCDWCPETWKGFSFLAFKDLWPASKLSISFGAMLS*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain