Glyma08g26540 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma08g26540

Feature Type:	gene_model
Chromosome:	Gm08
Start:	20878362
stop:	20879924
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma08g26540

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G39270	AT	Annotation by Michelle Graham. TAIR10: expansin A22 \| chr5:15729118-15730150 REVERSE LENGTH=263	SoyBase	E_val: 8.00E-101	ISS
GO:0009664	GO-bp	Annotation by Michelle Graham. GO Biological Process: plant-type cell wall organization	SoyBase	N/A	ISS
GO:0009826	GO-bp	Annotation by Michelle Graham. GO Biological Process: unidimensional cell growth	SoyBase	N/A	ISS
GO:0009828	GO-bp	Annotation by Michelle Graham. GO Biological Process: plant-type cell wall loosening	SoyBase	N/A	ISS
GO:0005576	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: extracellular region	SoyBase	N/A	ISS
PF01357	PFAM	Pollen allergen	JGI		ISS
PF03330	PFAM	Rare lipoprotein A (RlpA)-like double-psi beta-barrel	JGI		ISS
UniRef100_G7L585	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Alpha-expansin n=1 Tax=Medicago truncatula RepID=G7L585_MEDTR	SoyBase	E_val: 4.00E-115	ISS
UniRef100_I1KWD1	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=2 Tax=Glycine max RepID=I1KWD1_SOYBN	SoyBase	E_val: 7.00E-164	ISS

Expression Patterns of Glyma08g26540

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma08g26540

Paralog	Evidence	Comments
Glyma18g50030	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma08g26540 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.08g243200	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma08g26540

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma08g26540

Limit To All Plant Sequences

>Glyma08g26540.1   sequence type=CDS   gene model=Glyma08g26540   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGTCATGGGTAGGTCTCACTGTTTGGTTTCTTTGGCCTTTTTAATGGTTCTCTTTGTACCAGCCTTGTCACATGGCAGTCGTCATCGAAGAAGTGGATGGCATCTAGCCCATGCAACTTTCTATGGAGACATGCAAGGTGGAGACACCATGCAGGGTGCTTGTGGCTATGGTGATCTCTACCAGCAAGGTTATGGGCTAGAAACCACAGCCCTAAGCACAGCTCTATTCAACAATGGGCTCACTTGTGGTGCATGTTTTGAGATCATGTGTGTGAACGAGCCCCAATGGTGCATTCCCAACGCAGGCTCAATCAAAGTGACCGCAACAAATTTCTGCCCCCCTAATTACAACCCACCTAATTTCGACCATTGGTGCAACCCTCCACAAGAACACTTCGACTTGTCCATGAAAATGTTCACCAAAATTGCCATATACAGAGCAGGGATCATCCCAGTCATGTATCGCCGTGTCCCATGCAACAAAAGTGGCGGTGTCAAGTTTGAGATGAAAGGGAACCCTTATTGGTTGTTGGTTTTGTTGTACAATGTTGCCAGTGCTGGTGATGTTACTCAAGTGAGCATCAAAGGGTCTTCAAACACTGGCTGGAAATCTATGTCACGTGTTTGGGGACAGAATTGGGTTACTGGGTCTAATTTGGTAGGACAAGCCTTGTCATTTCAGGTCACTACTAGTGATGGTAAAATGATGGAGTTTGATAAT

Predicted protein sequences of Glyma08g26540

Limit To All Plant Sequences

>Glyma08g26540.1   sequence type=predicted peptide   gene model=Glyma08g26540   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MVMGRSHCLVSLAFLMVLFVPALSHGSRHRRSGWHLAHATFYGDMQGGDTMQGACGYGDLYQQGYGLETTALSTALFNNGLTCGACFEIMCVNEPQWCIPNAGSIKVTATNFCPPNYNPPNFDHWCNPPQEHFDLSMKMFTKIAIYRAGIIPVMYRRVPCNKSGGVKFEMKGNPYWLLVLLYNVASAGDVTQVSIKGSSNTGWKSMSRVWGQNWVTGSNLVGQALSFQVTTSDGKMMEFDN

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain