SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma08g26460

Feature Type:gene_model
Chromosome:Gm08
Start:20799554
stop:20801131
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G13810AT Annotation by Michelle Graham. TAIR10: indeterminate(ID)-domain 11 | chr3:4544941-4547300 FORWARD LENGTH=513 SoyBaseE_val: 6.00E-13ISS
GO:0006355GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0006635GO-bp Annotation by Michelle Graham. GO Biological Process: fatty acid beta-oxidation SoyBaseN/AISS
GO:0016558GO-bp Annotation by Michelle Graham. GO Biological Process: protein import into peroxisome matrix SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003676GO-mf Annotation by Michelle Graham. GO Molecular Function: nucleic acid binding SoyBaseN/AISS
GO:0003700GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity SoyBaseN/AISS
GO:0008270GO-mf Annotation by Michelle Graham. GO Molecular Function: zinc ion binding SoyBaseN/AISS
UniRef100_G7LHG9UniRef Annotation by Michelle Graham. Most informative UniRef hit: Zinc finger protein n=1 Tax=Medicago truncatula RepID=G7LHG9_MEDTR SoyBaseE_val: 1.00E-17ISS
UniRef100_I1KUT5UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KUT5_SOYBN SoyBaseE_val: 4.00E-24ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.08g242400 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma08g26460.1   sequence type=CDS   gene model=Glyma08g26460   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAGATGAAGGGTTTTATGTTCCAGCACCAACAGCAGCAGCAAGTAGGCGTGGAGGAAAACATCTGCAATTTGACTTCTGCATCTGGTGAAGCAAGTGCTGCTTCCTCAGGTAACAAAACTGAAATTGGAACCAATTACATGGCTCCACCACCATCTCAAACTCAACAACCAAAGAAAAAGAGAAACCTACTTGGCAACCCGGGTTTTTTCTTCCTATTTTTTTTCCTATTCAAACCTTGTCCCCCAAGAGTCTTCTTGCCACAAACAGGTTCATTTGTGACATCTGTAACAAAGAATTTCAAAGAGATAAGAACCTTTCGTTTCATTTTTAGAGGGCACAATTTTCCCTGGAAACTGAAATCAAGAAGCACTTCTGCAGAAAGCACGGTGAGAAGAAGTGCAAATGTCACTAGTGCTCCAAGAAGTATGCCGTTCAATCAGATTGGAAAGCTCACTCCAAATCCTGTGGCACTAGGGAGTACACATGTGACTGTCAAACCCACTTCTCAAGGAAGAATAAGGAAGAACAAGGGCAAAGTTGTAGGTTTGACACGAGTAAAGTGCCAAGAAGGTTGTCACTTTCTGACATTAAGTATACTACAATGGAGTTCAATCGAGATAGGCTTGTTGGGGAGGTTCAATTGTGCTGGACAATTGTTTGTCTATGGTGGCAATGAAATTGGATTTGAAGAAGTGTTGTTAAATTGGTTTTATTGGCAGTTGCTACTGAAATCATATAAACTGTGCATATCACTCTATAATATGTGA

>Glyma08g26460.1   sequence type=predicted peptide   gene model=Glyma08g26460   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MEMKGFMFQHQQQQQVGVEENICNLTSASGEASAASSGNKTEIGTNYMAPPPSQTQQPKKKRNLLGNPGFFFLFFFLFKPCPPRVFLPQTGSFVTSVTKNFKEIRTFRFIFRGHNFPWKLKSRSTSAESTVRRSANVTSAPRSMPFNQIGKLTPNPVALGSTHVTVKPTSQGRIRKNKGKVVGLTRVKCQEGCHFLTLSILQWSSIEIGLLGRFNCAGQLFVYGGNEIGFEEVLLNWFYWQLLLKSYKLCISLYNM*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo