Glyma08g26110 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma08g26110

Feature Type:	gene_model
Chromosome:	Gm08
Start:	20487572
stop:	20490589
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma08g26110

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G35460	AT	Annotation by Michelle Graham. TAIR10: basic helix-loop-helix (bHLH) DNA-binding superfamily protein \| chr1:13040092-13041907 FORWARD LENGTH=259	SoyBase	E_val: 3.00E-48	ISS
GO:0006355	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0003677	GO-mf	Annotation by Michelle Graham. GO Molecular Function: DNA binding	SoyBase	N/A	ISS
GO:0003700	GO-mf	Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity	SoyBase	N/A	ISS
PTHR16223	Panther	FAMILY NOT NAMED	JGI		ISS
PTHR16223:SF1	Panther	gb def: riken cdna 4933406n12 [mus musculus]	JGI		ISS
PF00010	PFAM	Helix-loop-helix DNA-binding domain	JGI		ISS
UniRef100_C6T578	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6T578_SOYBN	SoyBase	E_val: 3.00E-112	ISS
UniRef100_Q9C8P8	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Transcription factor bHLH80 n=1 Tax=Arabidopsis thaliana RepID=BH080_ARATH	SoyBase	E_val: 2.00E-45	ISS

Expression Patterns of Glyma08g26110

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma08g26110 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.08g239500	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma08g26110

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma08g26110

Limit To All Plant Sequences

>Glyma08g26110.1   sequence type=CDS   gene model=Glyma08g26110   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCAACCCACATCCGGCGGCGGCGGGCTGGCAAGGTTCCGTTCAGCTCCGGCGAGCTGGTTAGAATCAGTTCTGTTGAAGGAAGAGGAAGAAGAAGAAGACCCCTTAAGCTTCACTCAACTGCTTTCCACTATCGATGATGCTCCCTCTCATTCTCAACACCAACTCTATGGTGCCGCTCTCTCAAACAAGGATAAAACACCTGAAATCTTCATGTTAGAAGATTCCGTTCCTTGCAGAGTGAGGGCTAAGCGTGGCTGTGCTACTCATCCCAGGAGTATTGCTGAAAGGGTTCGCAGGACTCGTATCAGTGACCGCATCAGAAAGCTGCAAGAACTTGTGCCAAACATGGATAAGCAAACAAATACTGCAGATATGTTAGATGAGGCTGTAGCGTATGTCAAGTTTCTACAAAAGCAAATTGAGGAACTGTCAGAGCACCAACGGAGGTGTAAATGCGTGGTTCAAGAGTAA

Predicted protein sequences of Glyma08g26110

Limit To All Plant Sequences

>Glyma08g26110.1   sequence type=predicted peptide   gene model=Glyma08g26110   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MQPTSGGGGLARFRSAPASWLESVLLKEEEEEEDPLSFTQLLSTIDDAPSHSQHQLYGAALSNKDKTPEIFMLEDSVPCRVRAKRGCATHPRSIAERVRRTRISDRIRKLQELVPNMDKQTNTADMLDEAVAYVKFLQKQIEELSEHQRRCKCVVQE*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain