SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma08g25751): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma08g25751): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma08g25751

Feature Type:gene_model
Chromosome:Gm08
Start:20147998
stop:20150425
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma08g25751
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G06200AT Annotation by Michelle Graham. TAIR10: P-loop containing nucleoside triphosphate hydrolases superfamily protein | chr3:1877678-1878526 FORWARD LENGTH=282 SoyBaseE_val: 2.00E-22ISS
GO:0006163GO-bp Annotation by Michelle Graham. GO Biological Process: purine nucleotide metabolic process SoyBaseN/AISS
GO:0004385GO-mf Annotation by Michelle Graham. GO Molecular Function: guanylate kinase activity SoyBaseN/AISS
PTHR23117Panther GUANYLATE KINASE JGI ISS
PTHR23117:SF5Panther PREDICTED PROTEIN (FRAGMENT) JGI ISS
PF00625PFAM Guanylate kinase JGI ISS
UniRef100_G7JHQ2UniRef Annotation by Michelle Graham. Most informative UniRef hit: Flavonol synthase/flavanone 3-hydroxylase n=1 Tax=Medicago truncatula RepID=G7JHQ2_MEDTR SoyBaseE_val: 1.00E-25ISS
UniRef100_I1KW66UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=1 Tax=Glycine max RepID=I1KW66_SOYBN SoyBaseE_val: 2.00E-51ISS

Expression Patterns of Glyma08g25751
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma08g25751 not represented in the dataset
Glyma08g25751 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma08g25751 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.08g237000 Wm82.a2.v1IGC As supplied by JGI

References for Glyma08g25751
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma08g25751
>Glyma08g25751.1   sequence type=CDS   gene model=Glyma08g25751   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGTGTTGGTTGAGAGGCTCGTGGACCGGAAGGCGGAGATTATGGAGTCGTTGCTGGTGAGGATTGGTACTGCCAGGGAGGAGATGAAGCATGTCAAGAATTTTGATTATGTTGTGGTCAATGCGAAAGGGAAGCTTGATAATGCGGTCAAGTTGATGGAGTCTATTATTGATGCTAGAAAGCTAGGGTTTGTCAGAGGACTCCTCTCTTATAATGGACAGTCAACGTGTGAAGCTGGAAAAAAGTTGTATTCTCTAATTGCTCTTTCCTTGAATATGGATGAAGATTTCTTTGATAAGATAGGTGCCGTGGACAAACCATCAGCTTTTCTTCGCCTTTTGCGCTATCCACCAGGTGAAATGGGACCTCACCAAGAGATATGCTCTGCTCATTCAGATACTGGCGCGCTCACCCTCCTATTGACTGATGGAGTCCTAGGACTACAGGTTCTAACTTCCCTTTTGGTGCAACTTTAA
Predicted protein sequences of Glyma08g25751
>Glyma08g25751.1   sequence type=predicted peptide   gene model=Glyma08g25751   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MVLVERLVDRKAEIMESLLVRIGTAREEMKHVKNFDYVVVNAKGKLDNAVKLMESIIDARKLGFVRGLLSYNGQSTCEAGKKLYSLIALSLNMDEDFFDKIGAVDKPSAFLRLLRYPPGEMGPHQEICSAHSDTGALTLLLTDGVLGLQVLTSLLVQL*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo