Glyma08g25605 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma08g25605): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma08g25605): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma08g25605

Feature Type:	gene_model
Chromosome:	Gm08
Start:	19987404
stop:	19987757
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma08g25605

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
ATCG00330	AT	Annotation by Michelle Graham. TAIR10: chloroplast ribosomal protein S14 \| chrC:36938-37240 REVERSE LENGTH=100	SoyBase	E_val: 9.00E-30	ISS
GO:0006412	GO-bp	Annotation by Michelle Graham. GO Biological Process: translation	SoyBase	N/A	ISS
GO:0019243	GO-bp	Annotation by Michelle Graham. GO Biological Process: methylglyoxal catabolic process to D-lactate	SoyBase	N/A	ISS
GO:0045333	GO-bp	Annotation by Michelle Graham. GO Biological Process: cellular respiration	SoyBase	N/A	ISS
GO:0000312	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plastid small ribosomal subunit	SoyBase	N/A	ISS
GO:0005622	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: intracellular	SoyBase	N/A	ISS
GO:0005840	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: ribosome	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0009570	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast stroma	SoyBase	N/A	ISS
GO:0009941	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast envelope	SoyBase	N/A	ISS
GO:0003735	GO-mf	Annotation by Michelle Graham. GO Molecular Function: structural constituent of ribosome	SoyBase	N/A	ISS
PTHR19836	Panther	30S RIBOSOMAL PROTEIN S14	JGI		ISS
PTHR19836:SF10	Panther	SUBFAMILY NOT NAMED	JGI		ISS
PF00253	PFAM	Ribosomal protein S14p/S29e	JGI		ISS
UniRef100_G7JQC3	UniRef	Annotation by Michelle Graham. Best UniRef hit: 30S ribosomal protein S14 n=1 Tax=Medicago truncatula RepID=G7JQC3_MEDTR	SoyBase	E_val: 4.00E-30	ISS
UniRef100_G7JQC3	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: 30S ribosomal protein S14 n=1 Tax=Medicago truncatula RepID=G7JQC3_MEDTR	SoyBase	E_val: 4.00E-30	ISS

Expression Patterns of Glyma08g25605

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma08g25605 not represented in the dataset	Glyma08g25605 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma08g25605 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma08g25605

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma08g25605

Limit To All Plant Sequences

>Glyma08g25605.1   sequence type=CDS   gene model=Glyma08g25605   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
CCGCGTAATAGTGCACCTATACGTCTTCATCGACGTTGTTTTTCGACCGGAAGACCGCGAGCTAATTATCGAGACTTTGGATTATCCGGACACATATTTCGTGAAATGGTTCATGCATGTTTATTGCCCGGTGCAACAAGATCCAGTTGGAGGGTCCCTTTACCGTTATGTATAAATGGTTTATTCTATTTGTACAGATATGGTAAAGGGACGCATTCCATCTTTGTTTTTGTTTCTACATCGGTTAAAAGATGTTTTCTACGACGGTTTTTAACCATTGTCGTAATCAACATTGGTTAA

Predicted protein sequences of Glyma08g25605

Limit To All Plant Sequences

>Glyma08g25605.1   sequence type=predicted peptide   gene model=Glyma08g25605   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
PRNSAPIRLHRRCFSTGRPRANYRDFGLSGHIFREMVHACLLPGATRSSWRVPLPLCINGLFYLYRYGKGTHSIFVFVSTSVKRCFLRRFLTIVVINIG*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain