SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma08g25541): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma08g25541): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma08g25541

Feature Type:gene_model
Chromosome:Gm08
Start:19827278
stop:19829648
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma08g25541
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G17000AT Annotation by Michelle Graham. TAIR10: Zinc-binding dehydrogenase family protein | chr5:5584983-5586991 REVERSE LENGTH=345 SoyBaseE_val: 1.00E-64ISS
GO:0006865GO-bp Annotation by Michelle Graham. GO Biological Process: amino acid transport SoyBaseN/AISS
GO:0006979GO-bp Annotation by Michelle Graham. GO Biological Process: response to oxidative stress SoyBaseN/AISS
GO:0015824GO-bp Annotation by Michelle Graham. GO Biological Process: proline transport SoyBaseN/AISS
GO:0055114GO-bp Annotation by Michelle Graham. GO Biological Process: oxidation-reduction process SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0000166GO-mf Annotation by Michelle Graham. GO Molecular Function: nucleotide binding SoyBaseN/AISS
GO:0008270GO-mf Annotation by Michelle Graham. GO Molecular Function: zinc ion binding SoyBaseN/AISS
GO:0016491GO-mf Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity SoyBaseN/AISS
PTHR11695Panther ALCOHOL DEHYDROGENASE RELATED JGI ISS
PTHR11695:SF5Panther BENZYLALCOHOL DEHYDROGENASE JGI ISS
PF00107PFAM Zinc-binding dehydrogenase JGI ISS
UniRef100_B9SUZ9UniRef Annotation by Michelle Graham. Most informative UniRef hit: Alcohol dehydrogenase, putative n=1 Tax=Ricinus communis RepID=B9SUZ9_RICCO SoyBaseE_val: 1.00E-62ISS
UniRef100_UPI0002338F32UniRef Annotation by Michelle Graham. Best UniRef hit: UPI0002338F32 related cluster n=1 Tax=unknown RepID=UPI0002338F32 SoyBaseE_val: 5.00E-100ISS

Expression Patterns of Glyma08g25541
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma08g25541 not represented in the dataset
Glyma08g25541 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma08g25541 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.08g235500 Wm82.a2.v1IGC As supplied by JGI

References for Glyma08g25541
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma08g25541
>Glyma08g25541.1   sequence type=CDS   gene model=Glyma08g25541   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGCTACTATGTTGTTGGAAGTGCTGGAAGTAAAGATAAGGTTGAAATTTTGAAGAATAAGTTCGGGTTTGATGGGGCTTTTAATTACAAGGAGGAACAAGACCTGGATGCAACTTTGAAGAGGTTACTTGCTTCTACAATTGACATATACTTTGACAATGTTGGGGGAGACATACTTGAGGCAGCCCTTCTTAACATGAGAAGGCATGGACGAATTGCACCTCAAGGCATAAAGAACTTAGTGAATATCATATACAAGCAGATCAAAGTAGAAGCCTTCACAGTTTATGATTACTATCACCTCTATCCTAAATTCTTGGATACTGTTTTGCCTTACATTAGGGAAGGGAAGATAACATATGTTGAAGACATAACTGAGGGTCTTGAGAACGGTCCAATTGCACTAGAAGCAATGTTCCAAGGTCGTAGTGCTGGTAAACAAGTCATTATACTTGCTCGTGAATAA
Predicted protein sequences of Glyma08g25541
>Glyma08g25541.1   sequence type=predicted peptide   gene model=Glyma08g25541   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGYYVVGSAGSKDKVEILKNKFGFDGAFNYKEEQDLDATLKRLLASTIDIYFDNVGGDILEAALLNMRRHGRIAPQGIKNLVNIIYKQIKVEAFTVYDYYHLYPKFLDTVLPYIREGKITYVEDITEGLENGPIALEAMFQGRSAGKQVIILARE*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo