Glyma08g23230 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma08g23230): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma08g23230): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma08g23230

Feature Type:	gene_model
Chromosome:	Gm08
Start:	17701761
stop:	17706980
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma08g23230

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G80760	AT	Annotation by Michelle Graham. TAIR10: NOD26-like intrinsic protein 6;1 \| chr1:30350640-30352015 REVERSE LENGTH=305	SoyBase	E_val: 4.00E-155	ISS
GO:0006810	GO-bp	Annotation by Michelle Graham. GO Biological Process: transport	SoyBase	N/A	ISS
GO:0010264	GO-bp	Annotation by Michelle Graham. GO Biological Process: myo-inositol hexakisphosphate biosynthetic process	SoyBase	N/A	ISS
GO:0046713	GO-bp	Annotation by Michelle Graham. GO Biological Process: borate transport	SoyBase	N/A	ISS
GO:0080029	GO-bp	Annotation by Michelle Graham. GO Biological Process: cellular response to boron-containing substance levels	SoyBase	N/A	ISS
GO:0005886	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane	SoyBase	N/A	ISS
GO:0016020	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: membrane	SoyBase	N/A	ISS
GO:0005215	GO-mf	Annotation by Michelle Graham. GO Molecular Function: transporter activity	SoyBase	N/A	ISS
GO:0015168	GO-mf	Annotation by Michelle Graham. GO Molecular Function: glycerol transmembrane transporter activity	SoyBase	N/A	ISS
GO:0015204	GO-mf	Annotation by Michelle Graham. GO Molecular Function: urea transmembrane transporter activity	SoyBase	N/A	ISS
GO:0015250	GO-mf	Annotation by Michelle Graham. GO Molecular Function: water channel activity	SoyBase	N/A	ISS
GO:0046715	GO-mf	Annotation by Michelle Graham. GO Molecular Function: borate transmembrane transporter activity	SoyBase	N/A	ISS
KOG0223	KOG	Aquaporin (major intrinsic protein family)	JGI		ISS
PTHR19139	Panther	AQUAPORIN TRANSPORTER	JGI		ISS
PTHR19139:SF22	Panther	gb def: glycerol uptake facilitator protein [mycoplasma pulmonis]	JGI		ISS
PF00230	PFAM	Major intrinsic protein	JGI		ISS
UniRef100_I1KVK3	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KVK3_SOYBN	SoyBase	E_val: 0	ISS
UniRef100_Q6QIL3	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: NIP3 n=2 Tax=Medicago truncatula RepID=Q6QIL3_MEDTR	SoyBase	E_val: 1.00E-170	ISS

Expression Patterns of Glyma08g23230

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma08g23230 not represented in the dataset	Glyma08g23230 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma08g23230

Paralog	Evidence	Comments
Glyma07g02760	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma08g23230 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.08g217400	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma08g23230

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma08g23230

Limit To All Plant Sequences

>Glyma08g23230.1   sequence type=CDS   gene model=Glyma08g23230   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAACAACGAGGAAGTCCCATCATTACCTTCCACATCTGCAACACCAGGGACTCCCGGTGCTCCTCTCTTTGGTGGCCTCAGGTTTGAGAAACCTAATGGTAGTGTTGTTAGGAAATCGTCCTTCCTCAAAAGTTGCAAATGTTTCAGTGTTGCAGAATGGACTTTAGAAGACGGAGCCATGCCTAGAGTCTCTTGCTCTTTACCATCCCCTCATATCCCTCTCGCAAAAAAGATTGGAGCTGAGTTTATTGGCACGTTCATTTTGATGTTTGCCGCAATAGGCACTGCTATTGTGAACCAAAAGACACATGGATCAGAAACTTTGATCGGATGTGCTGCAGCCAATGGACTTGCTGTCATGATTATCATTTTCTCCACGGGCCATATCTCCGGGGCTCATCTCAATCCCGCTGTTACCATTTCCTTTGCTGCATTAAAGCACTTTCCCTGGAAAAATGTGCCTGTGTATATTGGTACACAAGTTTTGGCATCAGTAAGTGCTGCATTTGCTCTGAAAGTGGTTTTTCATCCGTTCATGAGCGGTGGAGTGACGGTCCCTTCAGTGGGATATGGGCAAGCTTTCGCCACAGAGTTCATTGTCAGCTTTATTCTTATGTTCGTTGTGACTGCAGTGGCCACCGACACAAGAGCTGTGGGAGAGCTCGCGGGAATCGCGGTGGGAGCCACTGTCATGCTCAACATACTCATAGCCGGGCCAACAACTGGAAGTTCAATGAACCCGGTTAGAACATTGGGTCCAGCAATAGCTGCAAACAACTACAAGGGCATATGGGTCTATCTCATAGCTCCCATACTTGGAACTCTATGTGGGGCAGGTGCCTACACTGTGGTCAAGCTGCCTGAAGAAGAGGCAACAAAGACACCTTCTTCTGCTCCTAATGGGAGCTTCAGAAGGTGA

Predicted protein sequences of Glyma08g23230

Limit To All Plant Sequences

>Glyma08g23230.1   sequence type=predicted peptide   gene model=Glyma08g23230   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MNNEEVPSLPSTSATPGTPGAPLFGGLRFEKPNGSVVRKSSFLKSCKCFSVAEWTLEDGAMPRVSCSLPSPHIPLAKKIGAEFIGTFILMFAAIGTAIVNQKTHGSETLIGCAAANGLAVMIIIFSTGHISGAHLNPAVTISFAALKHFPWKNVPVYIGTQVLASVSAAFALKVVFHPFMSGGVTVPSVGYGQAFATEFIVSFILMFVVTAVATDTRAVGELAGIAVGATVMLNILIAGPTTGSSMNPVRTLGPAIAANNYKGIWVYLIAPILGTLCGAGAYTVVKLPEEEATKTPSSAPNGSFRR*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain