SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma08g23120): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma08g23120): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma08g23120

Feature Type:gene_model
Chromosome:Gm08
Start:17611699
stop:17614488
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G33590AT Annotation by Michelle Graham. TAIR10: NAD(P)-binding Rossmann-fold superfamily protein | chr2:14224622-14226365 FORWARD LENGTH=321 SoyBaseE_val: 2.00E-98ISS
GO:0009408GO-bp Annotation by Michelle Graham. GO Biological Process: response to heat SoyBaseN/AISS
GO:0009414GO-bp Annotation by Michelle Graham. GO Biological Process: response to water deprivation SoyBaseN/AISS
GO:0009737GO-bp Annotation by Michelle Graham. GO Biological Process: response to abscisic acid stimulus SoyBaseN/AISS
GO:0009809GO-bp Annotation by Michelle Graham. GO Biological Process: lignin biosynthetic process SoyBaseN/AISS
GO:0046686GO-bp Annotation by Michelle Graham. GO Biological Process: response to cadmium ion SoyBaseN/AISS
GO:0005575GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cellular component SoyBaseN/AISS
GO:0000166GO-mf Annotation by Michelle Graham. GO Molecular Function: nucleotide binding SoyBaseN/AISS
GO:0003824GO-mf Annotation by Michelle Graham. GO Molecular Function: catalytic activity SoyBaseN/AISS
GO:0016621GO-mf Annotation by Michelle Graham. GO Molecular Function: cinnamoyl-CoA reductase activity SoyBaseN/AISS
GO:0050662GO-mf Annotation by Michelle Graham. GO Molecular Function: coenzyme binding SoyBaseN/AISS
KOG1502 KOG Flavonol reductase/cinnamoyl-CoA reductase JGI ISS
PTHR10366Panther NAD DEPENDENT EPIMERASE/DEHYDRATASE JGI ISS
PTHR10366:SF74Panther gb def: putative epimerase dehydratase, red superfamily, possibly udp-glucose 4-epimera JGI ISS
PF01073PFAM 3-beta hydroxysteroid dehydrogenase/isomerase family JGI ISS
UniRef100_G7IZT5UniRef Annotation by Michelle Graham. Most informative UniRef hit: Dihydroflavonol-4-reductase n=1 Tax=Medicago truncatula RepID=G7IZT5_MEDTR SoyBaseE_val: 5.00E-125ISS
UniRef100_UPI0002337FC7UniRef Annotation by Michelle Graham. Best UniRef hit: UPI0002337FC7 related cluster n=1 Tax=unknown RepID=UPI0002337FC7 SoyBaseE_val: 0ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma08g23120 not represented in the dataset

Glyma08g23120 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma07g02990 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.08g216200 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma08g23120.1   sequence type=CDS   gene model=Glyma08g23120   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTCCTCCCATAACCGCACTCTCTTCAAGGCAGATTTCTTGAATTACGAATCTCTTTGCTCAGCAATTTCTGGATGCACTGCAGTTTTCCATCTTGCTTGCCCTGTACCCTCAATTATTGTTCCCAACCCTCAGGTAGAAACGATTGAGCCTGCTGTGAAAGGAACCACTAATGTACTTGAAGCTAAAGTGCAACGACTTGTCTTTGTATCATCTATAGTTGCTATTTCCATTAACCCCAATTTACCTAAAGATAAAGTCATTGATGAGTCCTATTCGTCTGATAAAGATTACTGCAAAAGAACTCGGAACTGGTACTGTTTTTCCAAGACAGAGGCAGAGGAGCAGGCCCTTGACTTTGCCAAGAGAACTGGCCTTGATCTGGTAAGCATCTGCCCTTCCCTTGTGTTCTGGCCCATTTTACAGTCAACCACTGTTAATACCAGTAGCTTGGTTCTCCTCAAACTTTTAAAAGGTGTTGACTCATTGGAGAAGAAGATCCGTTGGATAGTGGATGTACGATATGTAGTTTATGCAATACTTTTGACTTATGAGAAGCTTGAGGCAAAAGGGAGATACGTATTCCATTCACATAACATCAAGACACGGGATATGCTGGAGAAACTGAAGAGTATATATCCCAGCTACAAATACCCTGCGAACTATACTGAGGTGGATGATTACATAAGTTTCAGCTCAGAGAAACTGCAAAGGTTGGGTTGGAAATACAGGTCACTGGAGGAAGCACTCATTGATTCTGTTGAGAGCTATCGGGAAGCTGGCCTCCTGCAATCAGAATAA

>Glyma08g23120.1   sequence type=predicted peptide   gene model=Glyma08g23120   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSSHNRTLFKADFLNYESLCSAISGCTAVFHLACPVPSIIVPNPQVETIEPAVKGTTNVLEAKVQRLVFVSSIVAISINPNLPKDKVIDESYSSDKDYCKRTRNWYCFSKTEAEEQALDFAKRTGLDLVSICPSLVFWPILQSTTVNTSSLVLLKLLKGVDSLEKKIRWIVDVRYVVYAILLTYEKLEAKGRYVFHSHNIKTRDMLEKLKSIYPSYKYPANYTEVDDYISFSSEKLQRLGWKYRSLEEALIDSVESYREAGLLQSE*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo