SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma08g23110): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma08g23110): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma08g23110

Feature Type:gene_model
Chromosome:Gm08
Start:17607814
stop:17608978
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G15810AT Annotation by Michelle Graham. TAIR10: S15/NS1, RNA-binding protein | chr1:5444496-5446271 FORWARD LENGTH=419 SoyBaseE_val: 9.00E-18ISS
GO:0000394GO-bp Annotation by Michelle Graham. GO Biological Process: RNA splicing, via endonucleolytic cleavage and ligation SoyBaseN/AISS
GO:0006412GO-bp Annotation by Michelle Graham. GO Biological Process: translation SoyBaseN/AISS
GO:0009086GO-bp Annotation by Michelle Graham. GO Biological Process: methionine biosynthetic process SoyBaseN/AISS
GO:0005622GO-cc Annotation by Michelle Graham. GO Cellular Compartment: intracellular SoyBaseN/AISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
GO:0005840GO-cc Annotation by Michelle Graham. GO Cellular Compartment: ribosome SoyBaseN/AISS
GO:0015935GO-cc Annotation by Michelle Graham. GO Cellular Compartment: small ribosomal subunit SoyBaseN/AISS
GO:0003735GO-mf Annotation by Michelle Graham. GO Molecular Function: structural constituent of ribosome SoyBaseN/AISS
PTHR23321Panther RIBOSOMAL PROTEIN S15, BACTERIAL AND ORGANELLAR JGI ISS
PTHR23321:SF9Panther UNCHARACTERIZED JGI ISS
PF00312PFAM Ribosomal protein S15 JGI ISS
UniRef100_G7JFN7UniRef Annotation by Michelle Graham. Most informative UniRef hit: 30S ribosomal protein S15 n=1 Tax=Medicago truncatula RepID=G7JFN7_MEDTR SoyBaseE_val: 7.00E-19ISS
UniRef100_I1KVI6UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KVI6_SOYBN SoyBaseE_val: 1.00E-108ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma08g23110 not represented in the dataset

Glyma08g23110 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma07g03000 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.08g216100 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma08g23110.2   sequence type=CDS   gene model=Glyma08g23110   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCCCTTGTTCTCCGTCTAGGAAGCAGAAGCAGAAGAAGAAGCGTGTTGTTCTTCTCCACCAACTCCAACTCTCCCTTATCTTCCCTTTTCAATGACAATCTCAAACAATCCTCTCCCTCAAACACCACGCGTTCCTCCTTTCGCACTCCCCCTAACTCCCAACCAGGTTTCACCGACGACATCAACAAAAACCTCCACGAATTCCGCGCCCGGACCACCGCGCCTCCACCGCAGCAAACCTCGTTCCAGAAGCAAACTATTCGTGATTATCTCAGACGTAACTTCGATCAGTTGGATCAGAATCAAACTGAGACCGCTAAGAAAGCTTCACGCCAGAGACTTAGCGTGGAGGAGAAATTGGGGATGTTGAGGCCGGAGGAAACGAAAAAGGATTGGTTTTCCGATGTTCATTCTCATAAAGGTTTGATAGCAATGGTTAAGAGGAGAAGAAGATTACTGAAATACCTTAAAAGAACTGATTGGGATTCCTATTGTTTTGTTATCTCCAAGCTAGAACTACGTGATAATCCTGATCATGGTTATAAAACACGATCGATC

>Glyma08g23110.2   sequence type=predicted peptide   gene model=Glyma08g23110   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MALVLRLGSRSRRRSVLFFSTNSNSPLSSLFNDNLKQSSPSNTTRSSFRTPPNSQPGFTDDINKNLHEFRARTTAPPPQQTSFQKQTIRDYLRRNFDQLDQNQTETAKKASRQRLSVEEKLGMLRPEETKKDWFSDVHSHKGLIAMVKRRRRLLKYLKRTDWDSYCFVISKLELRDNPDHGYKTRSI







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo