SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma08g22680): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma08g22680): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma08g22680

Feature Type:gene_model
Chromosome:Gm08
Start:17203414
stop:17204519
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G20230AT Annotation by Michelle Graham. TAIR10: blue-copper-binding protein | chr5:6826626-6827408 FORWARD LENGTH=196 SoyBaseE_val: 7.00E-25ISS
GO:0006979GO-bp Annotation by Michelle Graham. GO Biological Process: response to oxidative stress SoyBaseN/AISS
GO:0009611GO-bp Annotation by Michelle Graham. GO Biological Process: response to wounding SoyBaseN/AISS
GO:0009620GO-bp Annotation by Michelle Graham. GO Biological Process: response to fungus SoyBaseN/AISS
GO:0009646GO-bp Annotation by Michelle Graham. GO Biological Process: response to absence of light SoyBaseN/AISS
GO:0009695GO-bp Annotation by Michelle Graham. GO Biological Process: jasmonic acid biosynthetic process SoyBaseN/AISS
GO:0009753GO-bp Annotation by Michelle Graham. GO Biological Process: response to jasmonic acid stimulus SoyBaseN/AISS
GO:0015690GO-bp Annotation by Michelle Graham. GO Biological Process: aluminum cation transport SoyBaseN/AISS
GO:0050832GO-bp Annotation by Michelle Graham. GO Biological Process: defense response to fungus SoyBaseN/AISS
GO:0005773GO-cc Annotation by Michelle Graham. GO Cellular Compartment: vacuole SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0031225GO-cc Annotation by Michelle Graham. GO Cellular Compartment: anchored to membrane SoyBaseN/AISS
GO:0046658GO-cc Annotation by Michelle Graham. GO Cellular Compartment: anchored to plasma membrane SoyBaseN/AISS
GO:0005507GO-mf Annotation by Michelle Graham. GO Molecular Function: copper ion binding SoyBaseN/AISS
GO:0009055GO-mf Annotation by Michelle Graham. GO Molecular Function: electron carrier activity SoyBaseN/AISS
PF02298PFAM Plastocyanin-like domain JGI ISS
UniRef100_B9RV67UniRef Annotation by Michelle Graham. Most informative UniRef hit: Blue copper protein, putative n=1 Tax=Ricinus communis RepID=B9RV67_RICCO SoyBaseE_val: 3.00E-41ISS
UniRef100_I1KVF1UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KVF1_SOYBN SoyBaseE_val: 3.00E-122ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma08g22680 not represented in the dataset

Glyma08g22680 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.08g212500 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma08g22680.1   sequence type=CDS   gene model=Glyma08g22680   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAACAAGATGACTGGTCTTGCTCTTGGTGGAGTGGTGGCGGCTATTTTAATGGTTCTACAGTACGCAGAGGCACAGACAAGTTACGTTGTTGGAGATGGCACGGGTTGGAGAGTTCCACAAGATGCTTCCACATACCAAAATTGGGCTTCTGACAAGAATTTCACAGTTGGAGATACTCTATCATTCATTTTCCAGACAGGGTTGCATAACGTAATTGAAGTGTCGGAAGAGTCATACAATTCGTGCAGTTCAGCGAATCCTATAGGTACAACCTACAACACGGGCCCTGCCAACGTTACACTGAACAGAGGTGGTGAACATTACTACATTTGTAGCTTTGGTAATCACTGCAACAATGGGCAGAGGTTAGCCATCACTGTCTCTGGCTCTTCCACCGCCTTTCCACCAGCCACCACCACCGCTCCGCCACCACCTTCGTCTTCCGCGCCCTCTTCTTTCCATACTACTGTCCTTCCCTTCCTCTTCCTCTCCGCATTTGTCTTTATAGCGTTTTAG

>Glyma08g22680.1   sequence type=predicted peptide   gene model=Glyma08g22680   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MNKMTGLALGGVVAAILMVLQYAEAQTSYVVGDGTGWRVPQDASTYQNWASDKNFTVGDTLSFIFQTGLHNVIEVSEESYNSCSSANPIGTTYNTGPANVTLNRGGEHYYICSFGNHCNNGQRLAITVSGSSTAFPPATTTAPPPPSSSAPSSFHTTVLPFLFLSAFVFIAF*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo