SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma08g21730

Feature Type:gene_model
Chromosome:Gm08
Start:16535206
stop:16537175
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma08g21730
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G16240AT Annotation by Michelle Graham. TAIR10: delta tonoplast integral protein | chr3:5505534-5506788 FORWARD LENGTH=250 SoyBaseE_val: 7.00E-139ISS
GO:0006810GO-bp Annotation by Michelle Graham. GO Biological Process: transport SoyBaseN/AISS
GO:0006816GO-bp Annotation by Michelle Graham. GO Biological Process: calcium ion transport SoyBaseN/AISS
GO:0006833GO-bp Annotation by Michelle Graham. GO Biological Process: water transport SoyBaseN/AISS
GO:0007030GO-bp Annotation by Michelle Graham. GO Biological Process: Golgi organization SoyBaseN/AISS
GO:0009651GO-bp Annotation by Michelle Graham. GO Biological Process: response to salt stress SoyBaseN/AISS
GO:0015840GO-bp Annotation by Michelle Graham. GO Biological Process: urea transport SoyBaseN/AISS
GO:0030003GO-bp Annotation by Michelle Graham. GO Biological Process: cellular cation homeostasis SoyBaseN/AISS
GO:0055085GO-bp Annotation by Michelle Graham. GO Biological Process: transmembrane transport SoyBaseN/AISS
GO:0070838GO-bp Annotation by Michelle Graham. GO Biological Process: divalent metal ion transport SoyBaseN/AISS
GO:0000326GO-cc Annotation by Michelle Graham. GO Cellular Compartment: protein storage vacuole SoyBaseN/AISS
GO:0005618GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cell wall SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005773GO-cc Annotation by Michelle Graham. GO Cellular Compartment: vacuole SoyBaseN/AISS
GO:0005774GO-cc Annotation by Michelle Graham. GO Cellular Compartment: vacuolar membrane SoyBaseN/AISS
GO:0005794GO-cc Annotation by Michelle Graham. GO Cellular Compartment: Golgi apparatus SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0009505GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plant-type cell wall SoyBaseN/AISS
GO:0009506GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasmodesma SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0009705GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plant-type vacuole membrane SoyBaseN/AISS
GO:0009941GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast envelope SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0016021GO-cc Annotation by Michelle Graham. GO Cellular Compartment: integral to membrane SoyBaseN/AISS
GO:0042807GO-cc Annotation by Michelle Graham. GO Cellular Compartment: central vacuole SoyBaseN/AISS
GO:0005215GO-mf Annotation by Michelle Graham. GO Molecular Function: transporter activity SoyBaseN/AISS
GO:0015200GO-mf Annotation by Michelle Graham. GO Molecular Function: methylammonium transmembrane transporter activity SoyBaseN/AISS
GO:0015204GO-mf Annotation by Michelle Graham. GO Molecular Function: urea transmembrane transporter activity SoyBaseN/AISS
GO:0015250GO-mf Annotation by Michelle Graham. GO Molecular Function: water channel activity SoyBaseN/AISS
KOG0223 KOG Aquaporin (major intrinsic protein family) JGI ISS
PTHR19139Panther AQUAPORIN TRANSPORTER JGI ISS
PTHR19139:SF30Panther AQUAPORIN-7 JGI ISS
PF00230PFAM Major intrinsic protein JGI ISS
UniRef100_B9RQI0UniRef Annotation by Michelle Graham. Most informative UniRef hit: Tonoplast intrinsic protein, putative n=1 Tax=Ricinus communis RepID=B9RQI0_RICCO SoyBaseE_val: 2.00E-150ISS
UniRef100_I1KV43UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KV43_SOYBN SoyBaseE_val: 1.00E-169ISS

Expression Patterns of Glyma08g21730
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma08g21730
ParalogEvidenceComments
Glyma07g02060 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma08g21730 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.08g203000 Wm82.a2.v1IGC As supplied by JGI

References for Glyma08g21730
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma08g21730
>Glyma08g21730.1   sequence type=CDS   gene model=Glyma08g21730   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGTGGCATTGCATTTGGACGCTTTGATGATTCTTTCAGTTTAACCTCAATCAAGGCCTATATTGCTGAGTTCCATTCAACCTTGCTCTTTGTTTTTGCCGGTGTTGGTTCAGCCATAGCCTATGGTAAGTTGACATCAGATGCAGCACTTGATCCTGCTGGGTTACTGGCAGTTGCTATTTGCCACGGTTTTGCACTCTTTGTTGCAGTTTCTGTCGGTGCCAACATCTCTGGTGGCCATGTCAACCCTGCTGTGACTTTTGGATTGGCTCTTGGTGGCCACATCACCATCCTCACTGGCTTCTTCTACTGGATTGCACAGCTTCTTGGCTCCATCGTGGCATGTTTTCTTCTCAACTATGTCACAGGAGGCTTGCCAACTCCAATCCACAGTGTGGCTTCAGGGGTTGGAGCAGTTGAAGGAGTTGTGACCGAGATCATCATCACATTTGGTTTGGTGTACACAGTGTACGCCACAGCAGCAGATCCTAAGAAGGGCTCATTGGGAATCATTGCACCAATTGCCATTGGTTTCATTGTTGGTGCCAACATCTTGGCAGCAGGGCCATTCTCCGGCGGCTCGATGAACCCAGCACGCTCCTTCGGGCCTGCAGTTGTTAGTGGTGACTTCCATGACAACTGGATCTACTGGGTTGGACCTCTCATTGGTGGTGGTTTGGCTGGCCTTATCTATGGCAATGTCTTCATTCGCTCTGACCATGCACCTCTTTCCAGTGAATTTTGA
Predicted protein sequences of Glyma08g21730
>Glyma08g21730.1   sequence type=predicted peptide   gene model=Glyma08g21730   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGGIAFGRFDDSFSLTSIKAYIAEFHSTLLFVFAGVGSAIAYGKLTSDAALDPAGLLAVAICHGFALFVAVSVGANISGGHVNPAVTFGLALGGHITILTGFFYWIAQLLGSIVACFLLNYVTGGLPTPIHSVASGVGAVEGVVTEIIITFGLVYTVYATAADPKKGSLGIIAPIAIGFIVGANILAAGPFSGGSMNPARSFGPAVVSGDFHDNWIYWVGPLIGGGLAGLIYGNVFIRSDHAPLSSEF*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo