SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma08g21660

Feature Type:gene_model
Chromosome:Gm08
Start:16503432
stop:16503590
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma08g21660
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G27450AT Annotation by Michelle Graham. TAIR10: Aluminium induced protein with YGL and LRDR motifs | chr4:13727665-13728683 REVERSE LENGTH=250 SoyBaseE_val: 8.00E-12ISS
GO:0001666GO-bp Annotation by Michelle Graham. GO Biological Process: response to hypoxia SoyBaseN/AISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0009862GO-bp Annotation by Michelle Graham. GO Biological Process: systemic acquired resistance, salicylic acid mediated signaling pathway SoyBaseN/AISS
GO:0010310GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of hydrogen peroxide metabolic process SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0009506GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasmodesma SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
PF12504PFAM Aluminium induced protein JGI ISS
UniRef100_G7IP18UniRef Annotation by Michelle Graham. Most informative UniRef hit: Asparagine synthetase n=1 Tax=Medicago truncatula RepID=G7IP18_MEDTR SoyBaseE_val: 3.00E-11ISS
UniRef100_I1MEG4UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1MEG4_SOYBN SoyBaseE_val: 1.00E-12ISS

Expression Patterns of Glyma08g21660
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma08g21660 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.08g202500 Wm82.a2.v1IGC As supplied by JGI

References for Glyma08g21660
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma08g21660
>Glyma08g21660.1   sequence type=CDS   gene model=Glyma08g21660   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTTTCATAGTGAGCATGGTCTCATGAGCTTTGAATGCCGATCAAAGAAGATGAAAGCAATGCCTAGAATTGACTGTGAGGGATTTATGTGCGGTGCTAACTTTAGCGAAGTAAAAAATTGGATTTGTTGCATCTTTCAATTTCTTCTCCAAAGATAA
Predicted protein sequences of Glyma08g21660
>Glyma08g21660.1   sequence type=predicted peptide   gene model=Glyma08g21660   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MFHSEHGLMSFECRSKKMKAMPRIDCEGFMCGANFSEVKNWICCIFQFLLQR*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo