|
A newer version of this gene model can be found here:
Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
---|---|---|---|---|---|
AT4G27450 | AT | Annotation by Michelle Graham. TAIR10: Aluminium induced protein with YGL and LRDR motifs | chr4:13727665-13728683 REVERSE LENGTH=250 | SoyBase | E_val: 8.00E-12 | ISS |
GO:0001666 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to hypoxia | SoyBase | N/A | ISS |
GO:0008150 | GO-bp | Annotation by Michelle Graham. GO Biological Process: biological process | SoyBase | N/A | ISS |
GO:0009862 | GO-bp | Annotation by Michelle Graham. GO Biological Process: systemic acquired resistance, salicylic acid mediated signaling pathway | SoyBase | N/A | ISS |
GO:0010310 | GO-bp | Annotation by Michelle Graham. GO Biological Process: regulation of hydrogen peroxide metabolic process | SoyBase | N/A | ISS |
GO:0005634 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: nucleus | SoyBase | N/A | ISS |
GO:0005829 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: cytosol | SoyBase | N/A | ISS |
GO:0005886 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane | SoyBase | N/A | ISS |
GO:0009506 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: plasmodesma | SoyBase | N/A | ISS |
GO:0005515 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: protein binding | SoyBase | N/A | ISS |
PF12504 | PFAM | Aluminium induced protein | JGI | ISS | |
UniRef100_G7IP18 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Asparagine synthetase n=1 Tax=Medicago truncatula RepID=G7IP18_MEDTR | SoyBase | E_val: 3.00E-11 | ISS |
UniRef100_I1MEG4 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1MEG4_SOYBN | SoyBase | E_val: 1.00E-12 | ISS |
Glyma08g21660 not represented in the dataset |
Glyma08g21660 not represented in the dataset |
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
Corresponding Name | Annotation Version | Evidence | Comments |
---|---|---|---|
Glyma.08g202500 | Wm82.a2.v1 | IGC | As supplied by JGI |
Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma08g21660.1 sequence type=CDS gene model=Glyma08g21660 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGTTTCATAGTGAGCATGGTCTCATGAGCTTTGAATGCCGATCAAAGAAGATGAAAGCAATGCCTAGAATTGACTGTGAGGGATTTATGTGCGGTGCTAACTTTAGCGAAGTAAAAAATTGGATTTGTTGCATCTTTCAATTTCTTCTCCAAAGATAA
>Glyma08g21660.1 sequence type=predicted peptide gene model=Glyma08g21660 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MFHSEHGLMSFECRSKKMKAMPRIDCEGFMCGANFSEVKNWICCIFQFLLQR*
Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||