Glyma08g21510 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma08g21510

Feature Type:	gene_model
Chromosome:	Gm08
Start:	16332453
stop:	16334655
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma08g21510

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G16360	AT	Annotation by Michelle Graham. TAIR10: HPT phosphotransmitter 4 \| chr3:5554351-5555518 FORWARD LENGTH=145	SoyBase	E_val: 6.00E-76	ISS
GO:0000160	GO-bp	Annotation by Michelle Graham. GO Biological Process: phosphorelay signal transduction system	SoyBase	N/A	ISS
GO:0009736	GO-bp	Annotation by Michelle Graham. GO Biological Process: cytokinin mediated signaling pathway	SoyBase	N/A	ISS
GO:0080036	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of cytokinin mediated signaling pathway	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0005737	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm	SoyBase	N/A	ISS
GO:0004871	GO-mf	Annotation by Michelle Graham. GO Molecular Function: signal transducer activity	SoyBase	N/A	ISS
GO:0009927	GO-mf	Annotation by Michelle Graham. GO Molecular Function: histidine phosphotransfer kinase activity	SoyBase	N/A	ISS
GO:0016772	GO-mf	Annotation by Michelle Graham. GO Molecular Function: transferase activity, transferring phosphorus-containing groups	SoyBase	N/A	ISS
KOG4747	KOG	Two-component phosphorelay intermediate involved in MAP kinase cascade regulation	JGI		ISS
PF01627	PFAM	Hpt domain	JGI		ISS
UniRef100_G7IHZ9	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Histidine phosphotransfer protein n=1 Tax=Medicago truncatula RepID=G7IHZ9_MEDTR	SoyBase	E_val: 1.00E-87	ISS
UniRef100_UPI0002338C90	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI0002338C90 related cluster n=1 Tax=unknown RepID=UPI0002338C90	SoyBase	E_val: 1.00E-106	ISS

Proteins Associated with Glyma08g21510

Locus	Gene Symbol	Protein Name
	HP08	Ubiquitous, Phosphotransfer Protein

Expression Patterns of Glyma08g21510

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma08g21510

Paralog	Evidence	Comments
Glyma07g01840	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma08g21510 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.08g201100	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma08g21510

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma08g21510

Limit To All Plant Sequences

>Glyma08g21510.1   sequence type=CDS   gene model=Glyma08g21510   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGACAGAAACCAATCCCGCAGGCAGGTTGCTGCAATGAAACAGTCCCTCTTTGATCAGGGGTTACTTGATGAACAGTTTATCCAACTGGAAGAATTGCAGGATGATGCAAATCCTAACTTTGTTGAAGAAATTGTGACTCTTCATTACCGTGATTCGTCGCGGCTTATCTCAAGCATAGAGCAGGCTCTCAAAGAGAGGAACCCTCTGGATTTCAACAAGCTGGACACACTTATGCATCAGTTCAAAGGAAGCAGCTCAAGCATAGGAGCCAAAAAGGTGAAAACAGAGTGTAATCTGTTCAGAGAATATTGCAGGGCAGGAAATGCAGAAGGATGCATGAGGAGCTTCCAACAACTGAAGAGAGAATATGCAGCACTGAGAAAGAAACTTGAAGCTTATTTTCAGTTAGCTAGGCAAGCTGGACCCCAGGAAACAGCATGTCGCTCCAAATGA

Predicted protein sequences of Glyma08g21510

Limit To All Plant Sequences

>Glyma08g21510.1   sequence type=predicted peptide   gene model=Glyma08g21510   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MDRNQSRRQVAAMKQSLFDQGLLDEQFIQLEELQDDANPNFVEEIVTLHYRDSSRLISSIEQALKERNPLDFNKLDTLMHQFKGSSSSIGAKKVKTECNLFREYCRAGNAEGCMRSFQQLKREYAALRKKLEAYFQLARQAGPQETACRSK*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain