Glyma08g21340 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma08g21340): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma08g21340): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma08g21340

Feature Type:	gene_model
Chromosome:	Gm08
Start:	16195831
stop:	16198280
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma08g21340

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G16370	AT	Annotation by Michelle Graham. TAIR10: GDSL-like Lipase/Acylhydrolase superfamily protein \| chr3:5556928-5558351 FORWARD LENGTH=353	SoyBase	E_val: 0	ISS
GO:0000038	GO-bp	Annotation by Michelle Graham. GO Biological Process: very long-chain fatty acid metabolic process	SoyBase	N/A	ISS
GO:0000271	GO-bp	Annotation by Michelle Graham. GO Biological Process: polysaccharide biosynthetic process	SoyBase	N/A	ISS
GO:0006629	GO-bp	Annotation by Michelle Graham. GO Biological Process: lipid metabolic process	SoyBase	N/A	ISS
GO:0007389	GO-bp	Annotation by Michelle Graham. GO Biological Process: pattern specification process	SoyBase	N/A	ISS
GO:0008361	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of cell size	SoyBase	N/A	ISS
GO:0009664	GO-bp	Annotation by Michelle Graham. GO Biological Process: plant-type cell wall organization	SoyBase	N/A	ISS
GO:0009825	GO-bp	Annotation by Michelle Graham. GO Biological Process: multidimensional cell growth	SoyBase	N/A	ISS
GO:0009832	GO-bp	Annotation by Michelle Graham. GO Biological Process: plant-type cell wall biogenesis	SoyBase	N/A	ISS
GO:0009926	GO-bp	Annotation by Michelle Graham. GO Biological Process: auxin polar transport	SoyBase	N/A	ISS
GO:0009932	GO-bp	Annotation by Michelle Graham. GO Biological Process: cell tip growth	SoyBase	N/A	ISS
GO:0010015	GO-bp	Annotation by Michelle Graham. GO Biological Process: root morphogenesis	SoyBase	N/A	ISS
GO:0010817	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of hormone levels	SoyBase	N/A	ISS
GO:0040007	GO-bp	Annotation by Michelle Graham. GO Biological Process: growth	SoyBase	N/A	ISS
GO:0042335	GO-bp	Annotation by Michelle Graham. GO Biological Process: cuticle development	SoyBase	N/A	ISS
GO:0043481	GO-bp	Annotation by Michelle Graham. GO Biological Process: anthocyanin accumulation in tissues in response to UV light	SoyBase	N/A	ISS
GO:0048767	GO-bp	Annotation by Michelle Graham. GO Biological Process: root hair elongation	SoyBase	N/A	ISS
GO:0071555	GO-bp	Annotation by Michelle Graham. GO Biological Process: cell wall organization	SoyBase	N/A	ISS
GO:0005576	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: extracellular region	SoyBase	N/A	ISS
GO:0048046	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: apoplast	SoyBase	N/A	ISS
GO:0016788	GO-mf	Annotation by Michelle Graham. GO Molecular Function: hydrolase activity, acting on ester bonds	SoyBase	N/A	ISS
PTHR22835	Panther	ZINC FINGER FYVE DOMAIN CONTAINING PROTEIN	JGI		ISS
PTHR22835:SF39	Panther	LATERAL SIGNALING TARGET PROTEIN 2	JGI		ISS
PF00657	PFAM	GDSL-like Lipase/Acylhydrolase	JGI		ISS
UniRef100_B9RQB3	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Zinc finger protein, putative n=1 Tax=Ricinus communis RepID=B9RQB3_RICCO	SoyBase	E_val: 0	ISS
UniRef100_I1KV03	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=I1KV03_SOYBN	SoyBase	E_val: 0	ISS

Expression Patterns of Glyma08g21340

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma08g21340 not represented in the dataset	Glyma08g21340 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma08g21340

Paralog	Evidence	Comments
Glyma07g01680	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma08g21340 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.08g199500	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma08g21340

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma08g21340

Limit To All Plant Sequences

>Glyma08g21340.1   sequence type=CDS   gene model=Glyma08g21340   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCATATCCAAAGGAACAAAAATATTATTAAGATGATCAACATTATTGGAGCACTTGTTCTACTCTTTGCATTTCTCTTCCTCAGTTGTGTGTATGCACAAGACACAACAACCCTTGTGCCTGCAATCATAACTTTTGGTGATTCTGCTGTGGATGTAGGGAACAATGACTATCTTCCCACCCTTTTCAAGGCTGATTACCCTCCTTATGGGAGGGACTTTGTTAACCACCAACCTACTGGGAGGTTTTGCAATGGCAAATTAGCTACTGATTTCACTGCTGACACATTGGGTTTCAAGACCTATGCTCCAGCATATCTTAGCCCACATGCATCAGGGAAAAACCTCCTTATTGGAGCAAACTTTGCTTCAGCTGCATCTGGTTATGATGAAAATGCTGCTACTTTGAATCACGCGATTCCGTTGTCCCAACAGTTGAGTTATTTCAAGGAATACCAAGGCAAGCTGGCCAAGGTAGCTGGCAGTAAAAAAGCAGCCTCAATCATCAAGGATGCGTTGTATGTGCTCAGTGCTGGAAGCAGTGACTTTGTGCAAAATTATTATGTCAATCCTTGGATCAACAAAGTCTACACTCCTGATCAGTATTCGTCCTACTTAATTGGTTCATTCTCAAGTTTTGTTAAGGACTTGTATGGATTGGGAGGCAGGAGACTTGGAGTGACTTCACTCCCACCATTGGGTTGCCTACCTGCTGCAAGGACTATATTTGGTTTCCATGAGAATGGTTGTGTCTCAAGAATCAACACTGATGCTCAAGGATTTAACAAGAAGCTCAACTCAGCTGCAACGAGTCTTCAAAAGCAACTTCCTGGTCTTAAGATTGCGGTTTTCGACATTTACAAGCCTCTCTATGACCTTGTTCAATCCCCTTCAAAATCTGGTTTTGTGGAGGCAAACAGAGGATGCTGTGGTACCGGGACTGTAGAGACAACATCCTTGTTGTGTAATCCAAAATCACCAGGAACTTGTTCTAATGCCACACAGTATGTGTTTTGGGACAGTGTCCATCCTTCACAAGCTGCTAACCAAGTTCTAGCTGATGCATTAATTCTACAAGGCATATCTCTTGTCACATAA

Predicted protein sequences of Glyma08g21340

Limit To All Plant Sequences

>Glyma08g21340.1   sequence type=predicted peptide   gene model=Glyma08g21340   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MHIQRNKNIIKMINIIGALVLLFAFLFLSCVYAQDTTTLVPAIITFGDSAVDVGNNDYLPTLFKADYPPYGRDFVNHQPTGRFCNGKLATDFTADTLGFKTYAPAYLSPHASGKNLLIGANFASAASGYDENAATLNHAIPLSQQLSYFKEYQGKLAKVAGSKKAASIIKDALYVLSAGSSDFVQNYYVNPWINKVYTPDQYSSYLIGSFSSFVKDLYGLGGRRLGVTSLPPLGCLPAARTIFGFHENGCVSRINTDAQGFNKKLNSAATSLQKQLPGLKIAVFDIYKPLYDLVQSPSKSGFVEANRGCCGTGTVETTSLLCNPKSPGTCSNATQYVFWDSVHPSQAANQVLADALILQGISLVT*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain