SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma08g20820): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma08g20820): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma08g20820

Feature Type:gene_model
Chromosome:Gm08
Start:15796471
stop:15798993
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G17710AT Annotation by Michelle Graham. TAIR10: Pyridoxal phosphate phosphatase-related protein | chr1:6090763-6091975 REVERSE LENGTH=279 SoyBaseE_val: 1.00E-135ISS
GO:0008152GO-bp Annotation by Michelle Graham. GO Biological Process: metabolic process SoyBaseN/AISS
GO:0016036GO-bp Annotation by Michelle Graham. GO Biological Process: cellular response to phosphate starvation SoyBaseN/AISS
GO:0019375GO-bp Annotation by Michelle Graham. GO Biological Process: galactolipid biosynthetic process SoyBaseN/AISS
GO:0045892GO-bp Annotation by Michelle Graham. GO Biological Process: negative regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0016791GO-mf Annotation by Michelle Graham. GO Molecular Function: phosphatase activity SoyBaseN/AISS
GO:0052731GO-mf Annotation by Michelle Graham. GO Molecular Function: phosphocholine phosphatase activity SoyBaseN/AISS
GO:0052732GO-mf Annotation by Michelle Graham. GO Molecular Function: phosphoethanolamine phosphatase activity SoyBaseN/AISS
KOG3120 KOG Predicted haloacid dehalogenase-like hydrolase JGI ISS
PTHR20889Panther PHOSPHATASE, ORPHAN 1, 2 JGI ISS
PF06888PFAM Putative Phosphatase JGI ISS
UniRef100_D7PEX6UniRef Annotation by Michelle Graham. Most informative UniRef hit: Haloacid dehalogenase n=1 Tax=Phaseolus vulgaris RepID=D7PEX6_PHAVU SoyBaseE_val: 2.00E-173ISS
UniRef100_I1KUW3UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KUW3_SOYBN SoyBaseE_val: 0ISS

LocusGene SymbolProtein Name
ACP1 Acid phosphatase 1

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma08g20820 not represented in the dataset

Glyma08g20820 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma07g01430 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.08g195100 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma08g20820.1   sequence type=CDS   gene model=Glyma08g20820   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTCTGGAACCGTGATTGTTTTTGACTTTGACAAGACCATTGTCGATGTCGACAGTGACAACTGGGTCATCGACGAATTGGGTTTCACCGATTTGTTCAACCAGCTTCTTCCCACCATGCCTTGGAACTCTCTCATGGACAGGATGATGATGGAGCTTCATTCAAAAGGTAAGACCATAGAGGACATTGAAGAGGTTCTGCATAGGATTCCTTTGCACCCAAGAGTAATACCCGCTATTCAAGCAGCTCATGCTTTCGGGTGTGATTTGAGGATTGTGAGTGATGCAAACATGTTTTTCATTGAGACCATTCTGAAGCACTTGGGAATAAGGGAATACTTCTCGGAGATTAACACTAACCCAGGTTATGTTAACGAAGAAGGAAGGTTAAGGATTTTGCCTTACCATGACTTCAACAAAGCTTCCCATGGCTGCACTTTGTGTCCTCCAAATATGTGCAAGGGTTTAATCATTGATAGAATCCAAGATTCAATTTCACAAGAGGGTAACAAGAGGATGATCTATCTTGGTGATGGTAGTGGTGACTATTGCCCAAGCTTGAGGCTAAAAGAGAGAGACTATATGATGCCAAGGAAGAACTTTCCAGCGTGGGATTTGATATGCAAAGACCCTTTGCTTGTTAAGGCTGAAATTCATGGCTGGAGTGATGGAGAAGAGTTGGAGCAAGTTCTGTTGCACTTAATCGCCAAAATTTCAATGGAGGAAAATTCTCAGTTCATTTCATCTGATTGCAAGCTACAGACTCTCTCTGTCTCTGCTTTGGAGGGTTTGCCTAAAGTCCTCCCAGTTAGACCATAA

>Glyma08g20820.1   sequence type=predicted peptide   gene model=Glyma08g20820   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSGTVIVFDFDKTIVDVDSDNWVIDELGFTDLFNQLLPTMPWNSLMDRMMMELHSKGKTIEDIEEVLHRIPLHPRVIPAIQAAHAFGCDLRIVSDANMFFIETILKHLGIREYFSEINTNPGYVNEEGRLRILPYHDFNKASHGCTLCPPNMCKGLIIDRIQDSISQEGNKRMIYLGDGSGDYCPSLRLKERDYMMPRKNFPAWDLICKDPLLVKAEIHGWSDGEELEQVLLHLIAKISMEENSQFISSDCKLQTLSVSALEGLPKVLPVRP*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo