SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma08g20800): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma08g20800): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma08g20800

Feature Type:gene_model
Chromosome:Gm08
Start:15788014
stop:15790335
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G17710AT Annotation by Michelle Graham. TAIR10: Pyridoxal phosphate phosphatase-related protein | chr1:6090763-6091975 REVERSE LENGTH=279 SoyBaseE_val: 1.00E-105ISS
GO:0008152GO-bp Annotation by Michelle Graham. GO Biological Process: metabolic process SoyBaseN/AISS
GO:0016036GO-bp Annotation by Michelle Graham. GO Biological Process: cellular response to phosphate starvation SoyBaseN/AISS
GO:0019375GO-bp Annotation by Michelle Graham. GO Biological Process: galactolipid biosynthetic process SoyBaseN/AISS
GO:0045892GO-bp Annotation by Michelle Graham. GO Biological Process: negative regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0016791GO-mf Annotation by Michelle Graham. GO Molecular Function: phosphatase activity SoyBaseN/AISS
GO:0052731GO-mf Annotation by Michelle Graham. GO Molecular Function: phosphocholine phosphatase activity SoyBaseN/AISS
GO:0052732GO-mf Annotation by Michelle Graham. GO Molecular Function: phosphoethanolamine phosphatase activity SoyBaseN/AISS
KOG3120 KOG Predicted haloacid dehalogenase-like hydrolase JGI ISS
PTHR20889Panther PHOSPHATASE, ORPHAN 1, 2 JGI ISS
PF06888PFAM Putative Phosphatase JGI ISS
UniRef100_E5D6S8UniRef Annotation by Michelle Graham. Most informative UniRef hit: Acid phosphatase n=1 Tax=Phaseolus vulgaris RepID=E5D6S8_PHAVU SoyBaseE_val: 2.00E-148ISS
UniRef100_I1KUW1UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KUW1_SOYBN SoyBaseE_val: 0ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma08g20800 not represented in the dataset

Glyma08g20800 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma07g01400 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.08g194900 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma08g20800.1   sequence type=CDS   gene model=Glyma08g20800   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCTGGGATTGTAGTGATATTTGACTTTGACTCAACAATCATTGAGTGTGATAGTGATAATTGGGTGCTTGATGAGACCGGTTTAACTGAAAAGTTCTATCAGCTTCTTCCTAGCATGGCTTGGAACCCTCTAATGGATAAGATGATGAATGAACTTCATTCACAAGGGAAAACCATTCAAGACATTGTAGAAATTCTGAATAGGACACCAATGCATCCTAGGACTGTCCCTGCTATTGAGGCAGCTTATTCTCTTGGGTGTCACCTGAAGATTGTGAGTGACGCAAACATTTTCTTTATTGAAACAATCCTGAAGCATCATGGAGTGTGGAATTGTTTCTCAGAGGTCATAGCCAACCCCAGCCATGTCAATGAAGGGAGGCTCAATATTTGTCCATACCATGATTATCTTAAATCTTCTCATGGATGCAATCTTTGTCCACCAAACATGTGCAAGGGATTGGTGATAGAAAGGATCCAAAATTCCCTTGCAGCAGCAGGAAAGAAGAAAATAATCTATCTTGGAGATGGAAATGGAGATTTTTGCCCAAGTTTGAGGCTCAAAGATAGTGACTATTTGATGCCTAGAAAGGACTTTCCATTGTGTGATTTAGTTTCCAAAAATTCTAATAAGATAAAGGCAGAGGTACATGGTTGGAGAGATGGGAAAGAGCTTGAGCATGTTCTGCTACATGTTATCAACAAAGCTATTGGGGAAGGAAGCAACATTAACAATTCTACTCAGAAAGTCTCAGTTGATTGCAAGATGGGGCCCATTCCTATTGACACTCTTCAACCATTGCCTAAAGCCCTATCAGTTCCTCAGTAA

>Glyma08g20800.1   sequence type=predicted peptide   gene model=Glyma08g20800   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAGIVVIFDFDSTIIECDSDNWVLDETGLTEKFYQLLPSMAWNPLMDKMMNELHSQGKTIQDIVEILNRTPMHPRTVPAIEAAYSLGCHLKIVSDANIFFIETILKHHGVWNCFSEVIANPSHVNEGRLNICPYHDYLKSSHGCNLCPPNMCKGLVIERIQNSLAAAGKKKIIYLGDGNGDFCPSLRLKDSDYLMPRKDFPLCDLVSKNSNKIKAEVHGWRDGKELEHVLLHVINKAIGEGSNINNSTQKVSVDCKMGPIPIDTLQPLPKALSVPQ*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo