Report for Sequence Feature Glyma08g20531
Feature Type: gene_model
Chromosome: Gm08
Start: 15552396
stop: 15555349
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma08g20531
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
UniRef100_UPI00023392C6 UniRef
Annotation by Michelle Graham. Best UniRef hit: UPI00023392C6 related cluster n=1 Tax=unknown RepID=UPI00023392C6
SoyBase E_val: 3.00E-39 ISS
Expression Patterns of Glyma08g20531
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Paralogs of Glyma08g20531
Paralog Evidence Comments
Glyma07g01141 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma08g20531 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.08g192400 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma08g20531
Coding sequences of Glyma08g20531
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma08g20531.1 sequence type=CDS gene model=Glyma08g20531 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGGTTTTAAGTTGTCATTATCTCTACTACCTTGCATTAAGGGCTATTTTTGTTGGAGGCATAGCAGCATTTGCTAAAATAGCAGGAGCAATGAAAGCTGCAGGTGGTGCAAAAATGGGTGCAGCTGCTGCTGCTATGACGGCAGCAGCAACTGCAGCTGTGGCGGGGTCAAAACAAGAGCCGACTGATGCTTCTCAACAGTCTCCAAAATAA
Predicted protein sequences of Glyma08g20531
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma08g20531.1 sequence type=predicted peptide gene model=Glyma08g20531 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MVLSCHYLYYLALRAIFVGGIAAFAKIAGAMKAAGGAKMGAAAAAMTAAATAAVAGSKQEPTDASQQSPK*