Glyma08g20450 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma08g20450

Feature Type:	gene_model
Chromosome:	Gm08
Start:	15478705
stop:	15480741
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma08g20450

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G13882	AT	Annotation by Michelle Graham. TAIR10: Ribosomal protein L34 \| chr3:4574600-4575852 FORWARD LENGTH=147	SoyBase	E_val: 1.00E-36	ISS
GO:0006412	GO-bp	Annotation by Michelle Graham. GO Biological Process: translation	SoyBase	N/A	ISS
GO:0005622	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: intracellular	SoyBase	N/A	ISS
GO:0005739	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion	SoyBase	N/A	ISS
GO:0005840	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: ribosome	SoyBase	N/A	ISS
GO:0003735	GO-mf	Annotation by Michelle Graham. GO Molecular Function: structural constituent of ribosome	SoyBase	N/A	ISS
PTHR14503	Panther	FAMILY NOT NAMED	JGI		ISS
PF00468	PFAM	Ribosomal protein L34	JGI		ISS
UniRef100_C6SW51	UniRef	Annotation by Michelle Graham. Best UniRef hit: Ribosomal protein L34 n=1 Tax=Glycine max RepID=C6SW51_SOYBN	SoyBase	E_val: 3.00E-86	ISS
UniRef100_C6SW51	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Ribosomal protein L34 n=1 Tax=Glycine max RepID=C6SW51_SOYBN	SoyBase	E_val: 3.00E-86	ISS

Expression Patterns of Glyma08g20450

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma08g20450

Paralog	Evidence	Comments
Glyma07g01060	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma08g20450 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.08g191600	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma08g20450

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma08g20450

Limit To All Plant Sequences

>Glyma08g20450.1   sequence type=CDS   gene model=Glyma08g20450   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCGTCTCTGAGAAGTGGAGCTTCTTCGTTGTTGACTCGGCTATCCAAATCGCTTCTTCTTCATTCCAAAAACCCTAATCCTCATTCTCAGTTATTACTCCCTTCTCTCTCACGGCTCCCCGGTGCGATTTCTCCCCAAAACGACGCCGAATTCCCCCACAAACAAGGCTTTCTCTACCCCTGTGGCCTCCCCTCTCTCCGCTTCTTCTTACCTCAAGGGGACGCTCCTTCATCAGATGATCCTATGCTTTTATTCCCCAAAAGAACGTATCAACCAAGCGTTATTCGACGGAAGAGGAACCATGGATTTTTTGCTCGGAAAGCAACCAAGGGTGGCAGAAGAGTAATTGCTCGAAGATTAGCCAAGGGTCGGTTCAGGATCACTGCTTAG

Predicted protein sequences of Glyma08g20450

Limit To All Plant Sequences

>Glyma08g20450.1   sequence type=predicted peptide   gene model=Glyma08g20450   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MASLRSGASSLLTRLSKSLLLHSKNPNPHSQLLLPSLSRLPGAISPQNDAEFPHKQGFLYPCGLPSLRFFLPQGDAPSSDDPMLLFPKRTYQPSVIRRKRNHGFFARKATKGGRRVIARRLAKGRFRITA*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain