Report for Sequence Feature Glyma08g20410
Feature Type: gene_model
Chromosome: Gm08
Start: 15433491
stop: 15435142
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma08g20410
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT1G72690 AT
Annotation by Michelle Graham. TAIR10: unknown protein; BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT1G17490.1); Has 59 Blast hits to 45 proteins in 9 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi - 0; Plants - 59; Viruses - 0; Other Eukaryotes - 0 (source: NCBI BLink). | chr1:27361223-27361745 FORWARD LENGTH=87
SoyBase E_val: 9.00E-28 ISS
GO:0008150 GO-bp
Annotation by Michelle Graham. GO Biological Process: biological process
SoyBase N/A ISS
GO:0005634 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: nucleus
SoyBase N/A ISS
GO:0003674 GO-mf
Annotation by Michelle Graham. GO Molecular Function: molecular function
SoyBase N/A ISS
UniRef100_I1KUS3 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KUS3_SOYBN
SoyBase E_val: 4.00E-60 ISS
Expression Patterns of Glyma08g20410
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Paralogs of Glyma08g20410
Paralog Evidence Comments
Glyma07g01020 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma08g20410 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.08g191200 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma08g20410
Coding sequences of Glyma08g20410
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma08g20410.1 sequence type=CDS gene model=Glyma08g20410 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGGCGGATAGGGAACCAAAGCCTAAAGACTCGCCTTCAGAAAAAGATGTGAAAAGTCCAAACATTTTTGAGCGAGCTAAGGAGGAGATTGAGGCAGTGTTTCATCATGACAAATCGCCTCACCATCACAAAGAAACTCATGGGACAAGTGATGACATTGACGAGGGAACTTCACCTGATGAAATAAAAGCGCCTGGTGTGTTTGAACGGGTGAAGGAGGAGATTGAAGCTGTTGCTGAGGCCATTCATCCCAAGAAAGAATCTGAATCCGACACTCGTGATGTGTCACCAAAGTGA
Predicted protein sequences of Glyma08g20410
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma08g20410.1 sequence type=predicted peptide gene model=Glyma08g20410 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MADREPKPKDSPSEKDVKSPNIFERAKEEIEAVFHHDKSPHHHKETHGTSDDIDEGTSPDEIKAPGVFERVKEEIEAVAEAIHPKKESESDTRDVSPK*