Report for Sequence Feature Glyma08g20111
Feature Type: gene_model
Chromosome: Gm08
Start: 15189577
stop: 15190001
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma08g20111
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT1G60950 AT
Annotation by Michelle Graham. TAIR10: 2Fe-2S ferredoxin-like superfamily protein | chr1:22444565-22445011 FORWARD LENGTH=148
SoyBase E_val: 1.00E-43 ISS
GO:0009416 GO-bp
Annotation by Michelle Graham. GO Biological Process: response to light stimulus
SoyBase N/A ISS
GO:0009637 GO-bp
Annotation by Michelle Graham. GO Biological Process: response to blue light
SoyBase N/A ISS
GO:0009644 GO-bp
Annotation by Michelle Graham. GO Biological Process: response to high light intensity
SoyBase N/A ISS
GO:0009744 GO-bp
Annotation by Michelle Graham. GO Biological Process: response to sucrose stimulus
SoyBase N/A ISS
GO:0009767 GO-bp
Annotation by Michelle Graham. GO Biological Process: photosynthetic electron transport chain
SoyBase N/A ISS
GO:0009773 GO-bp
Annotation by Michelle Graham. GO Biological Process: photosynthetic electron transport in photosystem I
SoyBase N/A ISS
GO:0010114 GO-bp
Annotation by Michelle Graham. GO Biological Process: response to red light
SoyBase N/A ISS
GO:0010155 GO-bp
Annotation by Michelle Graham. GO Biological Process: regulation of proton transport
SoyBase N/A ISS
GO:0010207 GO-bp
Annotation by Michelle Graham. GO Biological Process: photosystem II assembly
SoyBase N/A ISS
GO:0010218 GO-bp
Annotation by Michelle Graham. GO Biological Process: response to far red light
SoyBase N/A ISS
GO:0022900 GO-bp
Annotation by Michelle Graham. GO Biological Process: electron transport chain
SoyBase N/A ISS
GO:0042742 GO-bp
Annotation by Michelle Graham. GO Biological Process: defense response to bacterium
SoyBase N/A ISS
GO:0009507 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: chloroplast
SoyBase N/A ISS
GO:0009570 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: chloroplast stroma
SoyBase N/A ISS
GO:0009055 GO-mf
Annotation by Michelle Graham. GO Molecular Function: electron carrier activity
SoyBase N/A ISS
GO:0051536 GO-mf
Annotation by Michelle Graham. GO Molecular Function: iron-sulfur cluster binding
SoyBase N/A ISS
GO:0051537 GO-mf
Annotation by Michelle Graham. GO Molecular Function: 2 iron, 2 sulfur cluster binding
SoyBase N/A ISS
PF00111 PFAM
2Fe-2S iron-sulfur cluster binding domain
JGI ISS
UniRef100_I1LTF2 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1LTF2_SOYBN
SoyBase E_val: 2.00E-61 ISS
UniRef100_Q43517 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: Ferredoxin-1, chloroplastic n=1 Tax=Solanum lycopersicum RepID=FER1_SOLLC
SoyBase E_val: 3.00E-49 ISS
Expression Patterns of Glyma08g20111
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Paralogs of Glyma08g20111
Paralog Evidence Comments
Glyma12g29090 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma08g20111 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.08g188500 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma08g20111
Coding sequences of Glyma08g20111
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma08g20111.1 sequence type=CDS gene model=Glyma08g20111 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGGCGACCACAGCGGCGTTGTGTGGCACTATGTTGAACACCTCCTTCCTGAGGAGGCAGGCTTCAGTGAACATCACAAGCCTCAAGGCTAACGCTAACACTGTGTTTGGTGTAAAGGGAGGACGTGGAGGCCTGATAACCCCAGAGGGAGAGCAAGAATTTGAATGCCCAGATGATGTATGCATTCTTGACCAGGCAGAGGAGAAAGGCCTTGAGCTTCCCTACTCATGCAGGGCTGGTTCTTGTTCTGTCTGTGCTGGCAAAGTGGAACAGTCAGATGGTAACTTCCTTGATGATGATCAAATTGTTGCAGGATTTGTTCTCACCCGTGTTGCTTACCCTACCTCAGACGTTGTCGTTGAGACTCACTGGGAGGAGGAGCTCACTGCTTAA
Predicted protein sequences of Glyma08g20111
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma08g20111.1 sequence type=predicted peptide gene model=Glyma08g20111 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MATTAALCGTMLNTSFLRRQASVNITSLKANANTVFGVKGGRGGLITPEGEQEFECPDDVCILDQAEEKGLELPYSCRAGSCSVCAGKVEQSDGNFLDDDQIVAGFVLTRVAYPTSDVVVETHWEEELTA*