Glyma08g19300 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma08g19300

Feature Type:	gene_model
Chromosome:	Gm08
Start:	14608427
stop:	14610038
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma08g19300

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G64530	AT	Annotation by Michelle Graham. TAIR10: xylem NAC domain 1 \| chr5:25795360-25796699 FORWARD LENGTH=187	SoyBase	E_val: 6.00E-82	ISS
GO:0006355	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent	SoyBase	N/A	ISS
GO:0007275	GO-bp	Annotation by Michelle Graham. GO Biological Process: multicellular organismal development	SoyBase	N/A	ISS
GO:0010089	GO-bp	Annotation by Michelle Graham. GO Biological Process: xylem development	SoyBase	N/A	ISS
GO:0043067	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of programmed cell death	SoyBase	N/A	ISS
GO:0048367	GO-bp	Annotation by Michelle Graham. GO Biological Process: shoot development	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0003677	GO-mf	Annotation by Michelle Graham. GO Molecular Function: DNA binding	SoyBase	N/A	ISS
GO:0003700	GO-mf	Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity	SoyBase	N/A	ISS
PF02365	PFAM	No apical meristem (NAM) protein	JGI		ISS
UniRef100_B9SQZ6	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: NAC domain-containing protein, putative n=1 Tax=Ricinus communis RepID=B9SQZ6_RICCO	SoyBase	E_val: 1.00E-91	ISS
UniRef100_I1KUF3	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KUF3_SOYBN	SoyBase	E_val: 1.00E-139	ISS

Proteins Associated with Glyma08g19300

Locus	Gene Symbol	Protein Name
	NAC062	NAC Transcription Factor gene 62

Expression Patterns of Glyma08g19300

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma08g19300

Paralog	Evidence	Comments
Glyma15g05690	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma08g19300 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.08g181100	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma08g19300

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma08g19300

Limit To All Plant Sequences

>Glyma08g19300.1   sequence type=CDS   gene model=Glyma08g19300   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGTGATAACAATGTCAACCTTCCACCCGGGTTTCGATTTTATCCCACAGATGAAGAGCTTGTAGTCCATTTCCTTCACAGAAAGGCATCTCTTTTACCTTGCCACCCAGATGCCATCCCTGATCTTGAAGTCTACCCATATGATCCATGGGAACTTGATGGTAGAGCTTTGGCAGAGGGAAACCAATGGTACTACTACAGCAGAAGGACACAAAATAGGGTCACTGGCAATGGGTATTGGAAACCAACGGGAATGGAAGAACCAGTGGTTTCAAGCACAAGCAACAAAAGGGTTGGCATGAAGAAATATTTTGTGTTCCATGTGGGAGAAGCCCCTACTGCTGGTATCAAAACCAATTGGATAATGCAAGAATATCGTCTATCAGATTCTGCTTCCTCTACCAGATCATCCAAAAGAAAACCACAACCAAAAATAGAATACAATAAATGGGTGATATGTCGTGTTTATGAGCGCAATGGAGACGATGATAATGGAACAGAGCTCTCATGCTTGGATGAAGTATTCTTGTCATTGGATGATGATCTTGATGAAATAAGCTTACCAAATTAA

Predicted protein sequences of Glyma08g19300

Limit To All Plant Sequences

>Glyma08g19300.1   sequence type=predicted peptide   gene model=Glyma08g19300   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGDNNVNLPPGFRFYPTDEELVVHFLHRKASLLPCHPDAIPDLEVYPYDPWELDGRALAEGNQWYYYSRRTQNRVTGNGYWKPTGMEEPVVSSTSNKRVGMKKYFVFHVGEAPTAGIKTNWIMQEYRLSDSASSTRSSKRKPQPKIEYNKWVICRVYERNGDDDNGTELSCLDEVFLSLDDDLDEISLPN*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain