SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma08g19230

Feature Type:gene_model
Chromosome:Gm08
Start:14507778
stop:14508755
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma08g19230
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G13830AT Annotation by Michelle Graham. TAIR10: DNAJ-like 20 | chr4:8011518-8012577 FORWARD LENGTH=197 SoyBaseE_val: 8.00E-16ISS
GO:0006457GO-bp Annotation by Michelle Graham. GO Biological Process: protein folding SoyBaseN/AISS
GO:0015996GO-bp Annotation by Michelle Graham. GO Biological Process: chlorophyll catabolic process SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0031072GO-mf Annotation by Michelle Graham. GO Molecular Function: heat shock protein binding SoyBaseN/AISS
PTHR25040Panther FAMILY NOT NAMED JGI ISS
PF00226PFAM DnaJ domain JGI ISS
UniRef100_G7INT0UniRef Annotation by Michelle Graham. Most informative UniRef hit: Chaperone protein dnaJ n=1 Tax=Medicago truncatula RepID=G7INT0_MEDTR SoyBaseE_val: 6.00E-45ISS
UniRef100_I1KUE6UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KUE6_SOYBN SoyBaseE_val: 4.00E-125ISS

Expression Patterns of Glyma08g19230
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma08g19230 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.08g180300 Wm82.a2.v1IGC As supplied by JGI

References for Glyma08g19230
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma08g19230
>Glyma08g19230.1   sequence type=CDS   gene model=Glyma08g19230   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGATGCATTAACCTTAAGCTCAAGTGTGAACATTTCCAAACCATTTCATTTCCTTACACTCTCAAAGAAACAGCAAAGAGAAAGACATCCTCGTACGCAGTTTGGTGTTTCATGCAGAGGCAGAAAAGAGCTTGGAGGAGGTGTGGAGGACAACTTGTACAAGGTACTAAGTTTGAGTCCCAAAAGTGCAACCACGGATGACATAAAGAAAGCATACAGATCAATGGCGCTTCGGTACCACCCTGATGTGTGCCAGGATTGTTCCAAGAAGGAGGAATCAACGAGGATGTTTGTGCAACTCAACGCAGCTTACCAGACCTTATCGAATCCTAGGCTTCGAGCAGAGTATGACTGTGAATTGGGTTTGAGAAGTGAAAAGATCGGTGTTGGTGATGAGACTTGGAGATATATATGGCAGAATCAACTTGCTGAGTTGAAGAGAAGGTCTCACATACGTATGGCACAAAACCAAGGATCATGGGGCAGTAGAATCAGACCGCAAAACATCAATTGA
Predicted protein sequences of Glyma08g19230
>Glyma08g19230.1   sequence type=predicted peptide   gene model=Glyma08g19230   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MDALTLSSSVNISKPFHFLTLSKKQQRERHPRTQFGVSCRGRKELGGGVEDNLYKVLSLSPKSATTDDIKKAYRSMALRYHPDVCQDCSKKEESTRMFVQLNAAYQTLSNPRLRAEYDCELGLRSEKIGVGDETWRYIWQNQLAELKRRSHIRMAQNQGSWGSRIRPQNIN*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo