Report for Sequence Feature Glyma08g19161
Feature Type: gene_model
Chromosome: Gm08
Start: 14460639
stop: 14462739
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma08g19161
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT2G26730 AT
Annotation by Michelle Graham. TAIR10: Leucine-rich repeat protein kinase family protein | chr2:11388621-11391286 FORWARD LENGTH=658
SoyBase E_val: 1.00E-36 ISS
GO:0000272 GO-bp
Annotation by Michelle Graham. GO Biological Process: polysaccharide catabolic process
SoyBase N/A ISS
GO:0005982 GO-bp
Annotation by Michelle Graham. GO Biological Process: starch metabolic process
SoyBase N/A ISS
GO:0006084 GO-bp
Annotation by Michelle Graham. GO Biological Process: acetyl-CoA metabolic process
SoyBase N/A ISS
GO:0006468 GO-bp
Annotation by Michelle Graham. GO Biological Process: protein phosphorylation
SoyBase N/A ISS
GO:0007020 GO-bp
Annotation by Michelle Graham. GO Biological Process: microtubule nucleation
SoyBase N/A ISS
GO:0007169 GO-bp
Annotation by Michelle Graham. GO Biological Process: transmembrane receptor protein tyrosine kinase signaling pathway
SoyBase N/A ISS
GO:0007389 GO-bp
Annotation by Michelle Graham. GO Biological Process: pattern specification process
SoyBase N/A ISS
GO:0008361 GO-bp
Annotation by Michelle Graham. GO Biological Process: regulation of cell size
SoyBase N/A ISS
GO:0009664 GO-bp
Annotation by Michelle Graham. GO Biological Process: plant-type cell wall organization
SoyBase N/A ISS
GO:0009832 GO-bp
Annotation by Michelle Graham. GO Biological Process: plant-type cell wall biogenesis
SoyBase N/A ISS
GO:0009926 GO-bp
Annotation by Michelle Graham. GO Biological Process: auxin polar transport
SoyBase N/A ISS
GO:0010015 GO-bp
Annotation by Michelle Graham. GO Biological Process: root morphogenesis
SoyBase N/A ISS
GO:0010075 GO-bp
Annotation by Michelle Graham. GO Biological Process: regulation of meristem growth
SoyBase N/A ISS
GO:0016126 GO-bp
Annotation by Michelle Graham. GO Biological Process: sterol biosynthetic process
SoyBase N/A ISS
GO:0016132 GO-bp
Annotation by Michelle Graham. GO Biological Process: brassinosteroid biosynthetic process
SoyBase N/A ISS
GO:0040007 GO-bp
Annotation by Michelle Graham. GO Biological Process: growth
SoyBase N/A ISS
GO:0005886 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane
SoyBase N/A ISS
GO:0004672 GO-mf
Annotation by Michelle Graham. GO Molecular Function: protein kinase activity
SoyBase N/A ISS
GO:0004674 GO-mf
Annotation by Michelle Graham. GO Molecular Function: protein serine/threonine kinase activity
SoyBase N/A ISS
GO:0004713 GO-mf
Annotation by Michelle Graham. GO Molecular Function: protein tyrosine kinase activity
SoyBase N/A ISS
GO:0005524 GO-mf
Annotation by Michelle Graham. GO Molecular Function: ATP binding
SoyBase N/A ISS
GO:0016772 GO-mf
Annotation by Michelle Graham. GO Molecular Function: transferase activity, transferring phosphorus-containing groups
SoyBase N/A ISS
PTHR24420 Panther
FAMILY NOT NAMED
JGI ISS
PTHR24420:SF779 Panther
JGI ISS
PF07714 PFAM
Protein tyrosine kinase
JGI ISS
UniRef100_G7INV2 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: Probably inactive leucine-rich repeat receptor-like protein kinase n=1 Tax=Medicago truncatula RepID=G7INV2_MEDTR
SoyBase E_val: 5.00E-105 ISS
UniRef100_I1MDW1 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=2 Tax=Glycine max RepID=I1MDW1_SOYBN
SoyBase E_val: 2.00E-118 ISS
Expression Patterns of Glyma08g19161
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Paralogs of Glyma08g19161
Paralog Evidence Comments
Glyma15g05840 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma08g19161 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.08g179500 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma08g19161
Coding sequences of Glyma08g19161
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma08g19161.1 sequence type=CDS gene model=Glyma08g19161 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGAATATTTCAATTTTTCTCAATGTGTTTCTTCTACCTGCAATTATATTGTTATTGCTGCTTTACTACAACACAACCAAAAAGCTCAACAAAATAAGAAAGGAACTCGTATTCTTTGATGATAAGGCAAAGTTTCAAATGGGTGAACTTCTTAGAGCTTCTGCGGAGGCACTGGGTCATGGAATCTTGGGAAATAGTTATAAGGCTATGCTGAATGATGGATCTACCATTGTAGTAAAGAGGCTAAGGGACTTAAAACCACTCTCTAAGGAGGAATTTGCAAAGATACTAAACGTGATTGCTGATATGAAGCACCCAAATTTGTTGTCATTGCTTGCTTATTATCATTCTAGAGACGAGAAGCTCATGCTCTACAGATATGCAGAGAATGGAAATCTTTTCTCCCGGCTTCATGTTGCAAGAGGAGTGGCACGAGCATTGGTGTACCTGCAGCTCAACCACAACAACATCGTCCCACACGGCAACTTGCGGTCTTCCAACGAAGACGACACAGTTCTTGTTTCAGACTTCGGCCTAGCCTCCTTGATAGCACAACCGATTGCAGCTCAGCACATGGTTGTTTACAAGTCACCCGAATTGAGGGAAGAATGGACTGCTGAGATATTTGACAAAGAGATTTGTGGCCAAAAGAGTGCACTTGCTGGGATGCTGATGCTGTTGCAGATTGCAATGCGTTGCATTGAGAGGTGA
Predicted protein sequences of Glyma08g19161
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma08g19161.1 sequence type=predicted peptide gene model=Glyma08g19161 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MNISIFLNVFLLPAIILLLLLYYNTTKKLNKIRKELVFFDDKAKFQMGELLRASAEALGHGILGNSYKAMLNDGSTIVVKRLRDLKPLSKEEFAKILNVIADMKHPNLLSLLAYYHSRDEKLMLYRYAENGNLFSRLHVARGVARALVYLQLNHNNIVPHGNLRSSNEDDTVLVSDFGLASLIAQPIAAQHMVVYKSPELREEWTAEIFDKEICGQKSALAGMLMLLQIAMRCIER*