SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Notice: fwrite(): Write of 158 bytes failed with errno=28 No space left on device in /var/www/html/include/SeqFeatClass.php on line 369

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma08g19161): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma08g19161): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma08g19161

Feature Type:gene_model
Chromosome:Gm08
Start:14460639
stop:14462739
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G26730AT Annotation by Michelle Graham. TAIR10: Leucine-rich repeat protein kinase family protein | chr2:11388621-11391286 FORWARD LENGTH=658 SoyBaseE_val: 1.00E-36ISS
GO:0000272GO-bp Annotation by Michelle Graham. GO Biological Process: polysaccharide catabolic process SoyBaseN/AISS
GO:0005982GO-bp Annotation by Michelle Graham. GO Biological Process: starch metabolic process SoyBaseN/AISS
GO:0006084GO-bp Annotation by Michelle Graham. GO Biological Process: acetyl-CoA metabolic process SoyBaseN/AISS
GO:0006468GO-bp Annotation by Michelle Graham. GO Biological Process: protein phosphorylation SoyBaseN/AISS
GO:0007020GO-bp Annotation by Michelle Graham. GO Biological Process: microtubule nucleation SoyBaseN/AISS
GO:0007169GO-bp Annotation by Michelle Graham. GO Biological Process: transmembrane receptor protein tyrosine kinase signaling pathway SoyBaseN/AISS
GO:0007389GO-bp Annotation by Michelle Graham. GO Biological Process: pattern specification process SoyBaseN/AISS
GO:0008361GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of cell size SoyBaseN/AISS
GO:0009664GO-bp Annotation by Michelle Graham. GO Biological Process: plant-type cell wall organization SoyBaseN/AISS
GO:0009832GO-bp Annotation by Michelle Graham. GO Biological Process: plant-type cell wall biogenesis SoyBaseN/AISS
GO:0009926GO-bp Annotation by Michelle Graham. GO Biological Process: auxin polar transport SoyBaseN/AISS
GO:0010015GO-bp Annotation by Michelle Graham. GO Biological Process: root morphogenesis SoyBaseN/AISS
GO:0010075GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of meristem growth SoyBaseN/AISS
GO:0016126GO-bp Annotation by Michelle Graham. GO Biological Process: sterol biosynthetic process SoyBaseN/AISS
GO:0016132GO-bp Annotation by Michelle Graham. GO Biological Process: brassinosteroid biosynthetic process SoyBaseN/AISS
GO:0040007GO-bp Annotation by Michelle Graham. GO Biological Process: growth SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0004672GO-mf Annotation by Michelle Graham. GO Molecular Function: protein kinase activity SoyBaseN/AISS
GO:0004674GO-mf Annotation by Michelle Graham. GO Molecular Function: protein serine/threonine kinase activity SoyBaseN/AISS
GO:0004713GO-mf Annotation by Michelle Graham. GO Molecular Function: protein tyrosine kinase activity SoyBaseN/AISS
GO:0005524GO-mf Annotation by Michelle Graham. GO Molecular Function: ATP binding SoyBaseN/AISS
GO:0016772GO-mf Annotation by Michelle Graham. GO Molecular Function: transferase activity, transferring phosphorus-containing groups SoyBaseN/AISS
PTHR24420Panther FAMILY NOT NAMED JGI ISS
PTHR24420:SF779Panther JGI ISS
PF07714PFAM Protein tyrosine kinase JGI ISS
UniRef100_G7INV2UniRef Annotation by Michelle Graham. Most informative UniRef hit: Probably inactive leucine-rich repeat receptor-like protein kinase n=1 Tax=Medicago truncatula RepID=G7INV2_MEDTR SoyBaseE_val: 5.00E-105ISS
UniRef100_I1MDW1UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=2 Tax=Glycine max RepID=I1MDW1_SOYBN SoyBaseE_val: 2.00E-118ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma08g19161 not represented in the dataset

Glyma08g19161 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma15g05840 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.08g179500 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma08g19161.1   sequence type=CDS   gene model=Glyma08g19161   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAATATTTCAATTTTTCTCAATGTGTTTCTTCTACCTGCAATTATATTGTTATTGCTGCTTTACTACAACACAACCAAAAAGCTCAACAAAATAAGAAAGGAACTCGTATTCTTTGATGATAAGGCAAAGTTTCAAATGGGTGAACTTCTTAGAGCTTCTGCGGAGGCACTGGGTCATGGAATCTTGGGAAATAGTTATAAGGCTATGCTGAATGATGGATCTACCATTGTAGTAAAGAGGCTAAGGGACTTAAAACCACTCTCTAAGGAGGAATTTGCAAAGATACTAAACGTGATTGCTGATATGAAGCACCCAAATTTGTTGTCATTGCTTGCTTATTATCATTCTAGAGACGAGAAGCTCATGCTCTACAGATATGCAGAGAATGGAAATCTTTTCTCCCGGCTTCATGTTGCAAGAGGAGTGGCACGAGCATTGGTGTACCTGCAGCTCAACCACAACAACATCGTCCCACACGGCAACTTGCGGTCTTCCAACGAAGACGACACAGTTCTTGTTTCAGACTTCGGCCTAGCCTCCTTGATAGCACAACCGATTGCAGCTCAGCACATGGTTGTTTACAAGTCACCCGAATTGAGGGAAGAATGGACTGCTGAGATATTTGACAAAGAGATTTGTGGCCAAAAGAGTGCACTTGCTGGGATGCTGATGCTGTTGCAGATTGCAATGCGTTGCATTGAGAGGTGA

>Glyma08g19161.1   sequence type=predicted peptide   gene model=Glyma08g19161   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MNISIFLNVFLLPAIILLLLLYYNTTKKLNKIRKELVFFDDKAKFQMGELLRASAEALGHGILGNSYKAMLNDGSTIVVKRLRDLKPLSKEEFAKILNVIADMKHPNLLSLLAYYHSRDEKLMLYRYAENGNLFSRLHVARGVARALVYLQLNHNNIVPHGNLRSSNEDDTVLVSDFGLASLIAQPIAAQHMVVYKSPELREEWTAEIFDKEICGQKSALAGMLMLLQIAMRCIER*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo