SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma08g18940): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma08g18940): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma08g18940

Feature Type:gene_model
Chromosome:Gm08
Start:14301903
stop:14304111
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma08g18940
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G50360AT Annotation by Michelle Graham. TAIR10: centrin2 | chr3:18674421-18675502 FORWARD LENGTH=169 SoyBaseE_val: 7.00E-65ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0030048GO-bp Annotation by Michelle Graham. GO Biological Process: actin filament-based movement SoyBaseN/AISS
GO:0051645GO-bp Annotation by Michelle Graham. GO Biological Process: Golgi localization SoyBaseN/AISS
GO:0051646GO-bp Annotation by Michelle Graham. GO Biological Process: mitochondrion localization SoyBaseN/AISS
GO:0060151GO-bp Annotation by Michelle Graham. GO Biological Process: peroxisome localization SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0005509GO-mf Annotation by Michelle Graham. GO Molecular Function: calcium ion binding SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
KOG0028 KOG Ca2+-binding protein (centrin/caltractin), EF-Hand superfamily protein JGI ISS
PTHR10891Panther CALMODULIN JGI ISS
PTHR10891:SF41Panther CALMODULIN RELATED JGI ISS
PF00036PFAM EF hand JGI ISS
UniRef100_G7KY76UniRef Annotation by Michelle Graham. Most informative UniRef hit: Caltractin n=1 Tax=Medicago truncatula RepID=G7KY76_MEDTR SoyBaseE_val: 7.00E-77ISS
UniRef100_I1KUB7UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KUB7_SOYBN SoyBaseE_val: 5.00E-99ISS

Expression Patterns of Glyma08g18940
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma08g18940 not represented in the dataset
Glyma08g18940 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma08g18940
ParalogEvidenceComments
Glyma15g06060 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma08g18940 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.08g177600 Wm82.a2.v1IGC As supplied by JGI

References for Glyma08g18940
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma08g18940
>Glyma08g18940.1   sequence type=CDS   gene model=Glyma08g18940   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTCATCTTTATATAGAGGAGAATCCAGGAGGTACAACAATAAACCAAGAGGACGTCATAATTTGACAACGCAGAAGAAGCAGGAGATTAAGGAAGCCTTTGAGTTATTTGATACTGATGGCTCAGGAACTATTGATGCCAAAGAGCTGAATGTTGCCATGAGGGCCCTTGGATTTGAGATGACAGAAGAGTACTTGATGACAGCCAAAATAGGAGAAAGGGACACTAAAGAGGAGCTCATGAAAGCTTTCAATATTATTGATCATGATAAAAATGGAAAGATATCTGCATTAGACATCAAGCGCATTGCAAAAGAGCTAGGACAAAATTTCACCGACAGAGAGATTCAGGAGATGGTTGATGAAGCAGACCAAGATAATGATCGAGAAGTTAGTGCAGAGGAGTTCATCACGATGATGAACAGAAATCGCTTCCATCACTAG
Predicted protein sequences of Glyma08g18940
>Glyma08g18940.1   sequence type=predicted peptide   gene model=Glyma08g18940   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSSLYRGESRRYNNKPRGRHNLTTQKKQEIKEAFELFDTDGSGTIDAKELNVAMRALGFEMTEEYLMTAKIGERDTKEELMKAFNIIDHDKNGKISALDIKRIAKELGQNFTDREIQEMVDEADQDNDREVSAEEFITMMNRNRFHH*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo