Report for Sequence Feature Glyma08g18781
Feature Type: gene_model
Chromosome: Gm08
Start: 14123190
stop: 14127949
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma08g18781
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT1G80245 AT
Annotation by Michelle Graham. TAIR10: Spc97 / Spc98 family of spindle pole body (SBP) component | chr1:30174547-30175217 FORWARD LENGTH=127
SoyBase E_val: 2.00E-26 ISS
GO:0000226 GO-bp
Annotation by Michelle Graham. GO Biological Process: microtubule cytoskeleton organization
SoyBase N/A ISS
GO:0006626 GO-bp
Annotation by Michelle Graham. GO Biological Process: protein targeting to mitochondrion
SoyBase N/A ISS
GO:0003674 GO-mf
Annotation by Michelle Graham. GO Molecular Function: molecular function
SoyBase N/A ISS
PTHR19302 Panther
GAMMA TUBULIN COMPLEX PROTEIN
JGI ISS
PTHR19302:SF29 Panther
UNKNOWN PROTEIN
JGI ISS
UniRef100_I1KU99 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=I1KU99_SOYBN
SoyBase E_val: 5.00E-106 ISS
Expression Patterns of Glyma08g18781
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Paralogs of Glyma08g18781
Paralog Evidence Comments
Glyma15g40100 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma08g18781 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.08g176100 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma08g18781
Coding sequences of Glyma08g18781
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma08g18781.1 sequence type=CDS gene model=Glyma08g18781 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGAAGGACAGACACATGAAGAAAAAAGTCAAAAGATTGAAAGACATGGTTGAGCCAGATAAAAATTGCGAGACTAGGGTTGAAGATGTTGCTTGGCTTTGCTCCCTTTCAGAGTCTGAGATCGACATGCTGATTAGCTTGAAATTGTTGATCATTCAGCGTGCAAAAATGATGGGTTGTAAAGAGCTGGCTAGTAAATTCAACCTTAAAATGATTCGAGCCATTGCACTTGTTTTGATGGAACATCTCAAGGCTGAGATAAAAGGTTCATCACTTATCCCCAACACGGTTGAATCTACTTCTTTTTTAGATGCTTGCAACCTATTGAAATGTAGCAATGAGGTTGATGCAAATATTGATGACCTAAGTGCAAGTCTTGGTGCTGATATTAGTGATATGCAAACTTTTCTTAGAAGTCCTCCAACATCCAAACAAAAGAAGCAGAAAGTTGGAAGCAGAGAATGA
Predicted protein sequences of Glyma08g18781
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma08g18781.1 sequence type=predicted peptide gene model=Glyma08g18781 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MKDRHMKKKVKRLKDMVEPDKNCETRVEDVAWLCSLSESEIDMLISLKLLIIQRAKMMGCKELASKFNLKMIRAIALVLMEHLKAEIKGSSLIPNTVESTSFLDACNLLKCSNEVDANIDDLSASLGADISDMQTFLRSPPTSKQKKQKVGSRE*