SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma08g18400

Feature Type:gene_model
Chromosome:Gm08
Start:13810824
stop:13811355
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma08g18400
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G12960AT Annotation by Michelle Graham. TAIR10: unknown protein; Has 44 Blast hits to 44 proteins in 14 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi - 0; Plants - 44; Viruses - 0; Other Eukaryotes - 0 (source: NCBI BLink). | chr3:4136546-4136806 FORWARD LENGTH=86 SoyBaseE_val: 3.00E-27ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
UniRef100_Q2XSH9UniRef Annotation by Michelle Graham. Most informative UniRef hit: Seed maturation protein n=2 Tax=Glycine RepID=Q2XSH9_GLYSO SoyBaseE_val: 4.00E-58ISS
UniRef100_Q2XSH9UniRef Annotation by Michelle Graham. Best UniRef hit: Seed maturation protein n=2 Tax=Glycine RepID=Q2XSH9_GLYSO SoyBaseE_val: 4.00E-58ISS

Expression Patterns of Glyma08g18400
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma08g18400 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.08g172800 Wm82.a2.v1IGC As supplied by JGI

References for Glyma08g18400
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma08g18400
>Glyma08g18400.1   sequence type=CDS   gene model=Glyma08g18400   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCGAAGAGCAAGGAAGACATAACCTATGCAACATCACAAGCAAGGCTTTCAGAAGATGAAGCAGTGAGAGTGGCCTACGAGCATGGCTCACCCCTTGAAGGAGGAAAGATTGCTGACTCTCAACCAGTTGACTTGTTTTCAAGTGCACACAATATGCCAAAGAGTGGCCAAACAACAATGGATTCAAACACTAGTGATCAATCTCAGATGCAACGTGATACACAAGAAGGGGGTTCTAAAGAATTCACCACTGGAGCTCCTGGATAG
Predicted protein sequences of Glyma08g18400
>Glyma08g18400.1   sequence type=predicted peptide   gene model=Glyma08g18400   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAKSKEDITYATSQARLSEDEAVRVAYEHGSPLEGGKIADSQPVDLFSSAHNMPKSGQTTMDSNTSDQSQMQRDTQEGGSKEFTTGAPG*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo