Glyma08g18340 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma08g18340

Feature Type:	gene_model
Chromosome:	Gm08
Start:	13778120
stop:	13779388
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma08g18340

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT2G32190	AT	Annotation by Michelle Graham. TAIR10: unknown protein; BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT2G32210.1); Has 218 Blast hits to 218 proteins in 24 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi - 16; Plants - 202; Viruses - 0; Other Eukaryotes - 0 (source: NCBI BLink). \| chr2:13674588-13675092 FORWARD LENGTH=71	SoyBase	E_val: 5.00E-16	ISS
GO:0008150	GO-bp	Annotation by Michelle Graham. GO Biological Process: biological process	SoyBase	N/A	ISS
GO:0010200	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to chitin	SoyBase	N/A	ISS
GO:0003674	GO-mf	Annotation by Michelle Graham. GO Molecular Function: molecular function	SoyBase	N/A	ISS
UniRef100_C6SYK8	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6SYK8_SOYBN	SoyBase	E_val: 3.00E-49	ISS
UniRef100_Q9SKY1	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Expressed protein n=1 Tax=Arabidopsis thaliana RepID=Q9SKY1_ARATH	SoyBase	E_val: 2.00E-13	ISS

Expression Patterns of Glyma08g18340

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma08g18340 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.08g172300	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma08g18340

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma08g18340

Limit To All Plant Sequences

>Glyma08g18340.1   sequence type=CDS   gene model=Glyma08g18340   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAATCACTCTAGCAACAATCAGCAAGAAACCCCTTTATCATATCTACCAGAAGGCCAGGCCAATTCTTCAGCTCCATATGTCACTGCCCCACCACCTATGGGTTATCCTTCTAAGAATGGTTCTATAGAACAAAGGGTTCCAGAGGAAACCACAAGCAGGGGTGATGGCTTCTGGAAGGGATGTTGTGCTGCTTTATGTTGCTGCTGTGTCCTGGATTGTGTCTTCTAA

Predicted protein sequences of Glyma08g18340

Limit To All Plant Sequences

>Glyma08g18340.1   sequence type=predicted peptide   gene model=Glyma08g18340   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MNHSSNNQQETPLSYLPEGQANSSAPYVTAPPPMGYPSKNGSIEQRVPEETTSRGDGFWKGCCAALCCCCVLDCVF*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain