SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma08g18330): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma08g18330): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma08g18330

Feature Type:gene_model
Chromosome:Gm08
Start:13771902
stop:13776607
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G12930AT Annotation by Michelle Graham. TAIR10: Lojap-related protein | chr3:4128465-4129616 FORWARD LENGTH=238 SoyBaseE_val: 4.00E-94ISS
GO:0006655GO-bp Annotation by Michelle Graham. GO Biological Process: phosphatidylglycerol biosynthetic process SoyBaseN/AISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0009073GO-bp Annotation by Michelle Graham. GO Biological Process: aromatic amino acid family biosynthetic process SoyBaseN/AISS
GO:0010103GO-bp Annotation by Michelle Graham. GO Biological Process: stomatal complex morphogenesis SoyBaseN/AISS
GO:0016226GO-bp Annotation by Michelle Graham. GO Biological Process: iron-sulfur cluster assembly SoyBaseN/AISS
GO:0019288GO-bp Annotation by Michelle Graham. GO Biological Process: isopentenyl diphosphate biosynthetic process, mevalonate-independent pathway SoyBaseN/AISS
GO:0045036GO-bp Annotation by Michelle Graham. GO Biological Process: protein targeting to chloroplast SoyBaseN/AISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
PTHR21043Panther IOJAP SUPERFAMILY ORTHOLOG JGI ISS
PF02410PFAM Domain of unknown function DUF143 JGI ISS
UniRef100_G7IJA0UniRef Annotation by Michelle Graham. Most informative UniRef hit: IojAP protein-like protein n=1 Tax=Medicago truncatula RepID=G7IJA0_MEDTR SoyBaseE_val: 9.00E-136ISS
UniRef100_I1KU48UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=I1KU48_SOYBN SoyBaseE_val: 6.00E-174ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma08g18330 not represented in the dataset

Glyma08g18330 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma15g40740 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.08g172200 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma08g18330.2   sequence type=CDS   gene model=Glyma08g18330   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCTACCATCATCCACTGTCCTATCTCTCGCCGGAACCCGCGCCGGCGTTCCGGTGAGCTTTTCCGGCGAACTGGGTCACCTCGAAACCAAGTTTTCTTCAAGACCCAGAAAGGTTTTCAGCCGTTCGTGCATAAAGGGGATTCCCTTACAACAAAACACCATCAATGGTTTGAATTCGAAGAACAGAAACTCACTTTCGAGCTTCGCATTCGGTAAAAAAGCCGAAGACAGCTTTTTCTCGGATGTAAATGGAGACACCGATGAAATGTATGATGAATTAATTAATAATTATGGAAAAGTGGTATTTAGTAGAAAAGACAAAAAGCCTGCTAGCGCAGAGATTGATGATGATGCTGAAAGCCTGTCATTTGCTGTGGAATTGGCCACGGTTGCAAGTGAGGTTAAGGCAGGAGATATAAAGGTCTTGTTTGTGAAGCCACTTGTTTACTGGACTCGATTTTTTATCATAGCTACAGCATTTTCTCGTCCCCAAATTGATGCTATCGGGTCCAGAATTAGAGATCGAGCTGAGAAGAAATATGGAAAAATTCCAACCGGAGACACAAAACCCAACTCATGGACTCTGTTGGACTTCGGTGATGTGGTTGTCCACATCTTCCTTCCCTCACAGAGAGCTTTCTACAATTTGGAAGAGTTTTATGGTAATGCCACACAAGTAGAGCTGCCTTTTGAAAATCAACCGCCACCATATCGCATTTGA

>Glyma08g18330.2   sequence type=predicted peptide   gene model=Glyma08g18330   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MLPSSTVLSLAGTRAGVPVSFSGELGHLETKFSSRPRKVFSRSCIKGIPLQQNTINGLNSKNRNSLSSFAFGKKAEDSFFSDVNGDTDEMYDELINNYGKVVFSRKDKKPASAEIDDDAESLSFAVELATVASEVKAGDIKVLFVKPLVYWTRFFIIATAFSRPQIDAIGSRIRDRAEKKYGKIPTGDTKPNSWTLLDFGDVVVHIFLPSQRAFYNLEEFYGNATQVELPFENQPPPYRI*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo