Report for Sequence Feature Glyma08g18330
Feature Type: gene_model
Chromosome: Gm08
Start: 13771902
stop: 13776607
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma08g18330
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT3G12930 AT
Annotation by Michelle Graham. TAIR10: Lojap-related protein | chr3:4128465-4129616 FORWARD LENGTH=238
SoyBase E_val: 4.00E-94 ISS
GO:0006655 GO-bp
Annotation by Michelle Graham. GO Biological Process: phosphatidylglycerol biosynthetic process
SoyBase N/A ISS
GO:0008150 GO-bp
Annotation by Michelle Graham. GO Biological Process: biological process
SoyBase N/A ISS
GO:0009073 GO-bp
Annotation by Michelle Graham. GO Biological Process: aromatic amino acid family biosynthetic process
SoyBase N/A ISS
GO:0010103 GO-bp
Annotation by Michelle Graham. GO Biological Process: stomatal complex morphogenesis
SoyBase N/A ISS
GO:0016226 GO-bp
Annotation by Michelle Graham. GO Biological Process: iron-sulfur cluster assembly
SoyBase N/A ISS
GO:0019288 GO-bp
Annotation by Michelle Graham. GO Biological Process: isopentenyl diphosphate biosynthetic process, mevalonate-independent pathway
SoyBase N/A ISS
GO:0045036 GO-bp
Annotation by Michelle Graham. GO Biological Process: protein targeting to chloroplast
SoyBase N/A ISS
GO:0005739 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion
SoyBase N/A ISS
GO:0009507 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: chloroplast
SoyBase N/A ISS
PTHR21043 Panther
IOJAP SUPERFAMILY ORTHOLOG
JGI ISS
PF02410 PFAM
Domain of unknown function DUF143
JGI ISS
UniRef100_G7IJA0 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: IojAP protein-like protein n=1 Tax=Medicago truncatula RepID=G7IJA0_MEDTR
SoyBase E_val: 9.00E-136 ISS
UniRef100_I1KU48 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=I1KU48_SOYBN
SoyBase E_val: 6.00E-174 ISS
Expression Patterns of Glyma08g18330
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Paralogs of Glyma08g18330
Paralog Evidence Comments
Glyma15g40740 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma08g18330 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.08g172200 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma08g18330
Coding sequences of Glyma08g18330
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma08g18330.2 sequence type=CDS gene model=Glyma08g18330 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGCTACCATCATCCACTGTCCTATCTCTCGCCGGAACCCGCGCCGGCGTTCCGGTGAGCTTTTCCGGCGAACTGGGTCACCTCGAAACCAAGTTTTCTTCAAGACCCAGAAAGGTTTTCAGCCGTTCGTGCATAAAGGGGATTCCCTTACAACAAAACACCATCAATGGTTTGAATTCGAAGAACAGAAACTCACTTTCGAGCTTCGCATTCGGTAAAAAAGCCGAAGACAGCTTTTTCTCGGATGTAAATGGAGACACCGATGAAATGTATGATGAATTAATTAATAATTATGGAAAAGTGGTATTTAGTAGAAAAGACAAAAAGCCTGCTAGCGCAGAGATTGATGATGATGCTGAAAGCCTGTCATTTGCTGTGGAATTGGCCACGGTTGCAAGTGAGGTTAAGGCAGGAGATATAAAGGTCTTGTTTGTGAAGCCACTTGTTTACTGGACTCGATTTTTTATCATAGCTACAGCATTTTCTCGTCCCCAAATTGATGCTATCGGGTCCAGAATTAGAGATCGAGCTGAGAAGAAATATGGAAAAATTCCAACCGGAGACACAAAACCCAACTCATGGACTCTGTTGGACTTCGGTGATGTGGTTGTCCACATCTTCCTTCCCTCACAGAGAGCTTTCTACAATTTGGAAGAGTTTTATGGTAATGCCACACAAGTAGAGCTGCCTTTTGAAAATCAACCGCCACCATATCGCATTTGA
Predicted protein sequences of Glyma08g18330
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma08g18330.2 sequence type=predicted peptide gene model=Glyma08g18330 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MLPSSTVLSLAGTRAGVPVSFSGELGHLETKFSSRPRKVFSRSCIKGIPLQQNTINGLNSKNRNSLSSFAFGKKAEDSFFSDVNGDTDEMYDELINNYGKVVFSRKDKKPASAEIDDDAESLSFAVELATVASEVKAGDIKVLFVKPLVYWTRFFIIATAFSRPQIDAIGSRIRDRAEKKYGKIPTGDTKPNSWTLLDFGDVVVHIFLPSQRAFYNLEEFYGNATQVELPFENQPPPYRI*