SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma08g18211): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma08g18211): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma08g18211

Feature Type:gene_model
Chromosome:Gm08
Start:13684294
stop:13688826
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma08g18211
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G22150AT Annotation by Michelle Graham. TAIR10: sulfate transporter 1;3 | chr1:7818361-7821344 FORWARD LENGTH=656 SoyBaseE_val: 2.00E-71ISS
GO:0006810GO-bp Annotation by Michelle Graham. GO Biological Process: transport SoyBaseN/AISS
GO:0008272GO-bp Annotation by Michelle Graham. GO Biological Process: sulfate transport SoyBaseN/AISS
GO:0055085GO-bp Annotation by Michelle Graham. GO Biological Process: transmembrane transport SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0016021GO-cc Annotation by Michelle Graham. GO Cellular Compartment: integral to membrane SoyBaseN/AISS
GO:0005215GO-mf Annotation by Michelle Graham. GO Molecular Function: transporter activity SoyBaseN/AISS
GO:0008271GO-mf Annotation by Michelle Graham. GO Molecular Function: secondary active sulfate transmembrane transporter activity SoyBaseN/AISS
GO:0015116GO-mf Annotation by Michelle Graham. GO Molecular Function: sulfate transmembrane transporter activity SoyBaseN/AISS
PTHR11814Panther SULFATE TRANSPORTER JGI ISS
PTHR11814:SF46Panther SUBFAMILY NOT NAMED JGI ISS
PF00916PFAM Sulfate transporter family JGI ISS
UniRef100_D4IIB4UniRef Annotation by Michelle Graham. Most informative UniRef hit: Sulphate transporter n=1 Tax=Astragalus crotalariae RepID=D4IIB4_9FABA SoyBaseE_val: 4.00E-84ISS
UniRef100_I1MDV4UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1MDV4_SOYBN SoyBaseE_val: 3.00E-93ISS

Expression Patterns of Glyma08g18211
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma08g18211 not represented in the dataset
Glyma08g18211 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma08g18211 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.08g171100 Wm82.a2.v1IGC As supplied by JGI

References for Glyma08g18211
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma08g18211
>Glyma08g18211.1   sequence type=CDS   gene model=Glyma08g18211   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCAGTGACCGAAGCTCAGAATCCTCTTCTTGTAGAAAACACATGTGGTTCCTTGTTAAAAAAGCTTCAGGTAACTAAGTTCATTCAGCTGAAAGAAGATAAAAAACAAAGGCTGCACAAGGACATTGCATACGCAAAGCTTGCAAATTTGGATCCCCAATATGCACTCTACACCAGTTTTGTGTGTCCTCTTGTGTATGCAATCATGGGAAGCTCAAGAGATATTTCCATAGTACCTGTAGTTGTGGTGTCCCTCTTGCTTGGGACTTTGCTAACCGATGAGATCAGTGACTTCAAATCTCATGAATACCTGCGTCTTGCAGGAGCCACTCAAATGGCACTCGATGTTCTCAGGCTTGGTTTCTTGATTGACTTTTTGTCCCATGCTTCCATTGTGGGATTCATGGATAGAGCTGCCATTACTATTGCACTACAACAACTTAAGGGTTTTCTTGGCATAAAAACATTCACCAAGAAAACTGATATTGTTTCTGTCATGCGCTCGGTTTTCAATGCAGCACATCATGGGTGGAATTGCAAGACAATAGTCATTGCAGTAGCATTCTTGGCTTTCCTTCTTATAACCAAGTATATTGCTAAAAAGAATAAGAAGCTCTTTGGGTGGCTGCAATTTCTCCTATGA
Predicted protein sequences of Glyma08g18211
>Glyma08g18211.1   sequence type=predicted peptide   gene model=Glyma08g18211   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAVTEAQNPLLVENTCGSLLKKLQVTKFIQLKEDKKQRLHKDIAYAKLANLDPQYALYTSFVCPLVYAIMGSSRDISIVPVVVVSLLLGTLLTDEISDFKSHEYLRLAGATQMALDVLRLGFLIDFLSHASIVGFMDRAAITIALQQLKGFLGIKTFTKKTDIVSVMRSVFNAAHHGWNCKTIVIAVAFLAFLLITKYIAKKNKKLFGWLQFLL*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo