SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma08g18121): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma08g18121): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma08g18121

Feature Type:gene_model
Chromosome:Gm08
Start:13602834
stop:13604018
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G56070AT Annotation by Michelle Graham. TAIR10: Ribosomal protein S5/Elongation factor G/III/V family protein | chr1:20968245-20971077 REVERSE LENGTH=843 SoyBaseE_val: 3.00E-102ISS
GO:0009409GO-bp Annotation by Michelle Graham. GO Biological Process: response to cold SoyBaseN/AISS
GO:0005730GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleolus SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005774GO-cc Annotation by Michelle Graham. GO Cellular Compartment: vacuolar membrane SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0009506GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasmodesma SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0048046GO-cc Annotation by Michelle Graham. GO Cellular Compartment: apoplast SoyBaseN/AISS
GO:0003746GO-mf Annotation by Michelle Graham. GO Molecular Function: translation elongation factor activity SoyBaseN/AISS
GO:0003924GO-mf Annotation by Michelle Graham. GO Molecular Function: GTPase activity SoyBaseN/AISS
GO:0005507GO-mf Annotation by Michelle Graham. GO Molecular Function: copper ion binding SoyBaseN/AISS
GO:0005525GO-mf Annotation by Michelle Graham. GO Molecular Function: GTP binding SoyBaseN/AISS
GO:0008135GO-mf Annotation by Michelle Graham. GO Molecular Function: translation factor activity, nucleic acid binding SoyBaseN/AISS
PTHR23115Panther TRANSLATION FACTOR JGI ISS
PTHR23115:SF4Panther EUKARYOTIC TRANSLATION ELONGATION FACTOR 2 JGI ISS
PF00009PFAM Elongation factor Tu GTP binding domain JGI ISS
UniRef100_G7IH34UniRef Annotation by Michelle Graham. Most informative UniRef hit: Elongation factor EF-2 n=1 Tax=Medicago truncatula RepID=G7IH34_MEDTR SoyBaseE_val: 6.00E-106ISS
UniRef100_I1KU23UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KU23_SOYBN SoyBaseE_val: 1.00E-131ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma08g18121 not represented in the dataset

Glyma08g18121 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.08g170100 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma08g18121.1   sequence type=CDS   gene model=Glyma08g18121   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCTGCGCTTCACGTCACTGATGGAGCACTTGTGGTGGTGGACTGTGTTGAGGGTGTCTGTGTCCAGACAGAAACTGTGCTGAGACAGGCCCTTGGAGAAAGGGTTAAGCCTGTTTTGGTTGTTAACAAGATGGATAGGTGCTTCCTTGAACTCCACCTTGATGCAGAGGAGGCATACCTTACATTTCAGAGGGTTGTTGAGAGTGCAAATGTGATCATGGCAACCTATGAAGATGCAGCACTTGGTGATATTCAGGTATACCCTGAAAAGGGAACAGTTGCTTTTTCTGCTGGCTTGCATGGATGGGGTTTTACACTCACCAACTTTGCCAAGATGCATGCTTCCAAGTTTGGAGTTGATGAGGCAAAGATGATGAGTAGGCTTTGGGGTGAGAATTTCTTCGACTCTGCTACCAGAAAGTGGACCTACAAGCATACCGGGACTTCTACGTGCAAGCGCGGCTTTGTTATGTTCTGCTATGAACCGATCAAACAGGTTATTGAACTTTGCATGAGCGACCAGAGGGATGAGCGGAGGCCCAAAGGAGGTGGTCAGATCATTTCAACTGTGCTAGAAGAGCCTGCTATGCAGCCATGCTGA

>Glyma08g18121.1   sequence type=predicted peptide   gene model=Glyma08g18121   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAALHVTDGALVVVDCVEGVCVQTETVLRQALGERVKPVLVVNKMDRCFLELHLDAEEAYLTFQRVVESANVIMATYEDAALGDIQVYPEKGTVAFSAGLHGWGFTLTNFAKMHASKFGVDEAKMMSRLWGENFFDSATRKWTYKHTGTSTCKRGFVMFCYEPIKQVIELCMSDQRDERRPKGGGQIISTVLEEPAMQPC*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo