Glyma08g18056 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma08g18056

Feature Type:	gene_model
Chromosome:	Gm08
Start:	13571676
stop:	13573019
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma08g18056

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G12910	AT	Annotation by Michelle Graham. TAIR10: NAC (No Apical Meristem) domain transcriptional regulator superfamily protein \| chr3:4109417-4110648 FORWARD LENGTH=303	SoyBase	E_val: 4.00E-17	ISS
GO:0006355	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0003677	GO-mf	Annotation by Michelle Graham. GO Molecular Function: DNA binding	SoyBase	N/A	ISS
GO:0003700	GO-mf	Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity	SoyBase	N/A	ISS
UniRef100_G7IGZ8	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: NAC domain-containing protein n=1 Tax=Medicago truncatula RepID=G7IGZ8_MEDTR	SoyBase	E_val: 3.00E-47	ISS
UniRef100_I1KU15	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KU15_SOYBN	SoyBase	E_val: 7.00E-111	ISS

Expression Patterns of Glyma08g18056

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma08g18056 not represented in the dataset	Glyma08g18056 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma08g18056

Paralog	Evidence	Comments
Glyma15g40950	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma08g18056 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.08g169500	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma08g18056

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma08g18056

Limit To All Plant Sequences

>Glyma08g18056.1   sequence type=CDS   gene model=Glyma08g18056   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGATGCACGAGTTTCGCCTTCCTTCTAACAAAGACAACACCACCAACCTTCCCAGCTCCAAGAATTACGTAGATGTTCCCCAAGAAGCTGAAATTTGGACATTGTGTCGAATATTCAAGAGAAATGTCTCACAGAGAAAGCACACGCCAGACTTGAAACAATTATCTGCTAAGCGCCACTCCATTCATGACAAGAACTCAAGAATGAGCAACGTGGAGTTCAACAATACTAATCAAGAATCATATATAAACTTTGGTGGCCACTATCAGAATGAGCAGAAACCCGTGATTAACTACACAAACAGTGATCAAAGGAATCAGTATCATGTGATGACTCATCAGTTGTTTGCTGCTCCAGTGGCACAGCATCATCAGCAACCTCAACAACTAACTTCTCCATCTTCTAACTTTTGGCTTAACAGCCCTCCTGGGAACGACTTCTTCACGTTTGATAACTGGGATGAGCTTGGATCTGTAGTGAAGTTTGTGGTTGATTAG

Predicted protein sequences of Glyma08g18056

Limit To All Plant Sequences

>Glyma08g18056.1   sequence type=predicted peptide   gene model=Glyma08g18056   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MMHEFRLPSNKDNTTNLPSSKNYVDVPQEAEIWTLCRIFKRNVSQRKHTPDLKQLSAKRHSIHDKNSRMSNVEFNNTNQESYINFGGHYQNEQKPVINYTNSDQRNQYHVMTHQLFAAPVAQHHQQPQQLTSPSSNFWLNSPPGNDFFTFDNWDELGSVVKFVVD*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain