|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT3G12900 | AT | Annotation by Michelle Graham. TAIR10: 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein | chr3:4104576-4106112 FORWARD LENGTH=357 | SoyBase | E_val: 2.00E-35 | ISS |
| GO:0055114 | GO-bp | Annotation by Michelle Graham. GO Biological Process: oxidation-reduction process | SoyBase | N/A | ISS |
| GO:0071281 | GO-bp | Annotation by Michelle Graham. GO Biological Process: cellular response to iron ion | SoyBase | N/A | ISS |
| GO:0071369 | GO-bp | Annotation by Michelle Graham. GO Biological Process: cellular response to ethylene stimulus | SoyBase | N/A | ISS |
| GO:0071732 | GO-bp | Annotation by Michelle Graham. GO Biological Process: cellular response to nitric oxide | SoyBase | N/A | ISS |
| GO:0005737 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm | SoyBase | N/A | ISS |
| GO:0016491 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity | SoyBase | N/A | ISS |
| GO:0016706 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, 2-oxoglutarate as one donor, and incorporation of one atom each of oxygen into both donors | SoyBase | N/A | ISS |
| PTHR10209 | Panther | FE(II)/ ASCORBATE OXIDASE SUPERFAMILY | JGI | ISS | |
| UniRef100_G7IGZ6 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: 1-aminocyclopropane-1-carboxylate oxidase n=1 Tax=Medicago truncatula RepID=G7IGZ6_MEDTR | SoyBase | E_val: 1.00E-47 | ISS |
| UniRef100_UPI0002338E43 | UniRef | Annotation by Michelle Graham. Best UniRef hit: UPI0002338E43 related cluster n=1 Tax=unknown RepID=UPI0002338E43 | SoyBase | E_val: 8.00E-74 | ISS |
|
Glyma08g18011 not represented in the dataset |
Glyma08g18011 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma08g18011.1 sequence type=CDS gene model=Glyma08g18011 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGGCTCTAAGTTTCAACTCTTCAAATTCCTTGTATGACTTTGAGATTAGAGAGGGCAATGGTGTTAAAGGCGTGGCAGATTTAGGTTTATCAGAGTTGCCAGAGAGGACATGTGATGCTCCACCCATTGACTTGTCAAAGCTAAATGGACCTGAGCATGAGAAAGTGGTGGATGAGATTGTAAGAGCATCTGAAACTCTTGGCTTCTTTCAGGTGGTGAATCATGGTGTGCCTTTGGAGCTATTGGAATCACTTAAAGATGCAGCTCACACATTCTTCAACTTGCCACAAGAGAAGAAAGCGGTGTTCCGCACAGCAATTAGGCCAGGCCTAGTCACAAAACTTAGGTCTAGCTTTGTGCCTGAGAAATAG
>Glyma08g18011.1 sequence type=predicted peptide gene model=Glyma08g18011 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MALSFNSSNSLYDFEIREGNGVKGVADLGLSELPERTCDAPPIDLSKLNGPEHEKVVDEIVRASETLGFFQVVNHGVPLELLESLKDAAHTFFNLPQEKKAVFRTAIRPGLVTKLRSSFVPEK*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||