SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Notice: fwrite(): Write of 157 bytes failed with errno=28 No space left on device in /var/www/html/include/SeqFeatClass.php on line 369

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma08g18011): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma08g18011): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma08g18011

Feature Type:gene_model
Chromosome:Gm08
Start:13550639
stop:13551055
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G12900AT Annotation by Michelle Graham. TAIR10: 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein | chr3:4104576-4106112 FORWARD LENGTH=357 SoyBaseE_val: 2.00E-35ISS
GO:0055114GO-bp Annotation by Michelle Graham. GO Biological Process: oxidation-reduction process SoyBaseN/AISS
GO:0071281GO-bp Annotation by Michelle Graham. GO Biological Process: cellular response to iron ion SoyBaseN/AISS
GO:0071369GO-bp Annotation by Michelle Graham. GO Biological Process: cellular response to ethylene stimulus SoyBaseN/AISS
GO:0071732GO-bp Annotation by Michelle Graham. GO Biological Process: cellular response to nitric oxide SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0016491GO-mf Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity SoyBaseN/AISS
GO:0016706GO-mf Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, 2-oxoglutarate as one donor, and incorporation of one atom each of oxygen into both donors SoyBaseN/AISS
PTHR10209Panther FE(II)/ ASCORBATE OXIDASE SUPERFAMILY JGI ISS
UniRef100_G7IGZ6UniRef Annotation by Michelle Graham. Most informative UniRef hit: 1-aminocyclopropane-1-carboxylate oxidase n=1 Tax=Medicago truncatula RepID=G7IGZ6_MEDTR SoyBaseE_val: 1.00E-47ISS
UniRef100_UPI0002338E43UniRef Annotation by Michelle Graham. Best UniRef hit: UPI0002338E43 related cluster n=1 Tax=unknown RepID=UPI0002338E43 SoyBaseE_val: 8.00E-74ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma08g18011 not represented in the dataset

Glyma08g18011 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma08g18011.1   sequence type=CDS   gene model=Glyma08g18011   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCTCTAAGTTTCAACTCTTCAAATTCCTTGTATGACTTTGAGATTAGAGAGGGCAATGGTGTTAAAGGCGTGGCAGATTTAGGTTTATCAGAGTTGCCAGAGAGGACATGTGATGCTCCACCCATTGACTTGTCAAAGCTAAATGGACCTGAGCATGAGAAAGTGGTGGATGAGATTGTAAGAGCATCTGAAACTCTTGGCTTCTTTCAGGTGGTGAATCATGGTGTGCCTTTGGAGCTATTGGAATCACTTAAAGATGCAGCTCACACATTCTTCAACTTGCCACAAGAGAAGAAAGCGGTGTTCCGCACAGCAATTAGGCCAGGCCTAGTCACAAAACTTAGGTCTAGCTTTGTGCCTGAGAAATAG

>Glyma08g18011.1   sequence type=predicted peptide   gene model=Glyma08g18011   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MALSFNSSNSLYDFEIREGNGVKGVADLGLSELPERTCDAPPIDLSKLNGPEHEKVVDEIVRASETLGFFQVVNHGVPLELLESLKDAAHTFFNLPQEKKAVFRTAIRPGLVTKLRSSFVPEK*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo