Report for Sequence Feature Glyma08g17990
Feature Type: gene_model
Chromosome: Gm08
Start: 13516201
stop: 13521021
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma08g17990
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT1G31320 AT
Annotation by Michelle Graham. TAIR10: LOB domain-containing protein 4 | chr1:11213107-11214032 FORWARD LENGTH=172
SoyBase E_val: 9.00E-70 ISS
GO:0008150 GO-bp
Annotation by Michelle Graham. GO Biological Process: biological process
SoyBase N/A ISS
GO:0009855 GO-bp
Annotation by Michelle Graham. GO Biological Process: determination of bilateral symmetry
SoyBase N/A ISS
GO:0009944 GO-bp
Annotation by Michelle Graham. GO Biological Process: polarity specification of adaxial/abaxial axis
SoyBase N/A ISS
GO:0010014 GO-bp
Annotation by Michelle Graham. GO Biological Process: meristem initiation
SoyBase N/A ISS
GO:0010075 GO-bp
Annotation by Michelle Graham. GO Biological Process: regulation of meristem growth
SoyBase N/A ISS
GO:0005634 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: nucleus
SoyBase N/A ISS
PF03195 PFAM
Protein of unknown function DUF260
JGI ISS
UniRef100_B9RI26 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: LOB domain-containing protein, putative n=1 Tax=Ricinus communis RepID=B9RI26_RICCO
SoyBase E_val: 2.00E-85 ISS
UniRef100_I1KU11 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KU11_SOYBN
SoyBase E_val: 4.00E-128 ISS
Expression Patterns of Glyma08g17990
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Paralogs of Glyma08g17990
Paralog Evidence Comments
Glyma15g41020 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma08g17990 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.08g169000 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma08g17990
Coding sequences of Glyma08g17990
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma08g17990.1 sequence type=CDS gene model=Glyma08g17990 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGAAGGAAAGTGGAAGGAAACAAGGTACCATGTCGCCATGTGCGGCATGCAAGCTTCTTCGAAGGAGATGCACGCGAGATTGCGTGTTTGCTCCTTATTTTCCTGCTGATGAACCCCAGAAGTTTGGTAGTGTTCACAAGGTTTTCGGGGCTAGCAATGTAAACAAAATGTTACAGGAATTACCTGAGCACCAAAGAAGTGATGCAGTTAGTTCAATGGTATATGAAGCCAATGCAAGGGTGAGGGACCCTGTGTATGGATGTGTGGGAGCCATATCCTCTCTTCAACAACAAGTTGATGTGCTCCAAACCCAATTGGCACTAGCACAAGCAGAGGTTGTGCACATGAGAATGCGCCAATTCTCACCACCATCAGAACAACAACAACCCTCAGTGCTTCCTGAAGCCTCCAATTCATCATCAGAGAACTTGTACCACTCAAGCAGACTCTTGTCTTCACAAACCAAGTCCCTTTTTGGCATGGACATGGTCGTTGATCAGGCCAACATGGGGCAATCCTTGTGGTCATACTAG
Predicted protein sequences of Glyma08g17990
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma08g17990.1 sequence type=predicted peptide gene model=Glyma08g17990 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MKESGRKQGTMSPCAACKLLRRRCTRDCVFAPYFPADEPQKFGSVHKVFGASNVNKMLQELPEHQRSDAVSSMVYEANARVRDPVYGCVGAISSLQQQVDVLQTQLALAQAEVVHMRMRQFSPPSEQQQPSVLPEASNSSSENLYHSSRLLSSQTKSLFGMDMVVDQANMGQSLWSY*