Glyma08g17990 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma08g17990

Feature Type:	gene_model
Chromosome:	Gm08
Start:	13516201
stop:	13521021
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma08g17990

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G31320	AT	Annotation by Michelle Graham. TAIR10: LOB domain-containing protein 4 \| chr1:11213107-11214032 FORWARD LENGTH=172	SoyBase	E_val: 9.00E-70	ISS
GO:0008150	GO-bp	Annotation by Michelle Graham. GO Biological Process: biological process	SoyBase	N/A	ISS
GO:0009855	GO-bp	Annotation by Michelle Graham. GO Biological Process: determination of bilateral symmetry	SoyBase	N/A	ISS
GO:0009944	GO-bp	Annotation by Michelle Graham. GO Biological Process: polarity specification of adaxial/abaxial axis	SoyBase	N/A	ISS
GO:0010014	GO-bp	Annotation by Michelle Graham. GO Biological Process: meristem initiation	SoyBase	N/A	ISS
GO:0010075	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of meristem growth	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
PF03195	PFAM	Protein of unknown function DUF260	JGI		ISS
UniRef100_B9RI26	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: LOB domain-containing protein, putative n=1 Tax=Ricinus communis RepID=B9RI26_RICCO	SoyBase	E_val: 2.00E-85	ISS
UniRef100_I1KU11	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KU11_SOYBN	SoyBase	E_val: 4.00E-128	ISS

Expression Patterns of Glyma08g17990

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma08g17990

Paralog	Evidence	Comments
Glyma15g41020	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma08g17990 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.08g169000	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma08g17990

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma08g17990

Limit To All Plant Sequences

>Glyma08g17990.1   sequence type=CDS   gene model=Glyma08g17990   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAAGGAAAGTGGAAGGAAACAAGGTACCATGTCGCCATGTGCGGCATGCAAGCTTCTTCGAAGGAGATGCACGCGAGATTGCGTGTTTGCTCCTTATTTTCCTGCTGATGAACCCCAGAAGTTTGGTAGTGTTCACAAGGTTTTCGGGGCTAGCAATGTAAACAAAATGTTACAGGAATTACCTGAGCACCAAAGAAGTGATGCAGTTAGTTCAATGGTATATGAAGCCAATGCAAGGGTGAGGGACCCTGTGTATGGATGTGTGGGAGCCATATCCTCTCTTCAACAACAAGTTGATGTGCTCCAAACCCAATTGGCACTAGCACAAGCAGAGGTTGTGCACATGAGAATGCGCCAATTCTCACCACCATCAGAACAACAACAACCCTCAGTGCTTCCTGAAGCCTCCAATTCATCATCAGAGAACTTGTACCACTCAAGCAGACTCTTGTCTTCACAAACCAAGTCCCTTTTTGGCATGGACATGGTCGTTGATCAGGCCAACATGGGGCAATCCTTGTGGTCATACTAG

Predicted protein sequences of Glyma08g17990

Limit To All Plant Sequences

>Glyma08g17990.1   sequence type=predicted peptide   gene model=Glyma08g17990   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MKESGRKQGTMSPCAACKLLRRRCTRDCVFAPYFPADEPQKFGSVHKVFGASNVNKMLQELPEHQRSDAVSSMVYEANARVRDPVYGCVGAISSLQQQVDVLQTQLALAQAEVVHMRMRQFSPPSEQQQPSVLPEASNSSSENLYHSSRLLSSQTKSLFGMDMVVDQANMGQSLWSY*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain