SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma08g17793): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma08g17793): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma08g17793

Feature Type:gene_model
Chromosome:Gm08
Start:13268802
stop:13272542
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G23180AT Annotation by Michelle Graham. TAIR10: cysteine-rich RLK (RECEPTOR-like protein kinase) 10 | chr4:12138171-12140780 FORWARD LENGTH=669 SoyBaseE_val: 3.00E-56ISS
GO:0006468GO-bp Annotation by Michelle Graham. GO Biological Process: protein phosphorylation SoyBaseN/AISS
GO:0006995GO-bp Annotation by Michelle Graham. GO Biological Process: cellular response to nitrogen starvation SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0004672GO-mf Annotation by Michelle Graham. GO Molecular Function: protein kinase activity SoyBaseN/AISS
GO:0004674GO-mf Annotation by Michelle Graham. GO Molecular Function: protein serine/threonine kinase activity SoyBaseN/AISS
GO:0004713GO-mf Annotation by Michelle Graham. GO Molecular Function: protein tyrosine kinase activity SoyBaseN/AISS
GO:0005524GO-mf Annotation by Michelle Graham. GO Molecular Function: ATP binding SoyBaseN/AISS
GO:0016301GO-mf Annotation by Michelle Graham. GO Molecular Function: kinase activity SoyBaseN/AISS
GO:0016772GO-mf Annotation by Michelle Graham. GO Molecular Function: transferase activity, transferring phosphorus-containing groups SoyBaseN/AISS
PTHR24420Panther FAMILY NOT NAMED JGI ISS
PTHR24420:SF430Panther SUBFAMILY NOT NAMED JGI ISS
PF07714PFAM Protein tyrosine kinase JGI ISS
UniRef100_G7ZX63UniRef Annotation by Michelle Graham. Most informative UniRef hit: Cysteine-rich receptor-like protein kinase (Fragment) n=1 Tax=Medicago truncatula RepID=G7ZX63_MEDTR SoyBaseE_val: 8.00E-67ISS
UniRef100_I1KTZ1UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=1 Tax=Glycine max RepID=I1KTZ1_SOYBN SoyBaseE_val: 3.00E-123ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma08g17793 not represented in the dataset

Glyma08g17793 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.08g167300 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma08g17793.1   sequence type=CDS   gene model=Glyma08g17793   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAATCCCAAAATTTCAGATTTTGGCATGGCTAGAATTTTCACTCAAGAGTCAGATATAAACACTAAAAGGATTGTTGGGACATATGGTTACATGTCACCGGAATATGCAATGGAGGGAATTTTCTCTTTCGAATCTGATGTCTATGCTTTTGGAGTCTTGCTGCTAGAAATTATTAGTGGCAGAAAAAACAATACTGCTGAAGGGCCACTCAATCTAGTAGGACATGCTTGGGAGCTATGGAAACAAGGCCATGCACTAGACCTCTTAGATCCAACTTTAATAGAATCTTTCATTCAAAATGAAGTATTAAGATGCATTCATGTTGGTCTTTTATGTGTAGAAGAATGTGCAGCTGATCGCCCCAATATTTCAGAAATGATACCCATGTTAAACAGTGAAATTGCAACATTTCCATTGCCTAGAAGACCAGCATTTTACCGCGGAAAAAAGCTGGTTGAGGAATATGACTCTTTTATTGATAATGAAATCCATTCAGTGAATGGTTTAACTATTTCCAACATAGGTGGAAGATAA

>Glyma08g17793.1   sequence type=predicted peptide   gene model=Glyma08g17793   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MNPKISDFGMARIFTQESDINTKRIVGTYGYMSPEYAMEGIFSFESDVYAFGVLLLEIISGRKNNTAEGPLNLVGHAWELWKQGHALDLLDPTLIESFIQNEVLRCIHVGLLCVEECAADRPNISEMIPMLNSEIATFPLPRRPAFYRGKKLVEEYDSFIDNEIHSVNGLTISNIGGR*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo