SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma08g17702

Feature Type:gene_model
Chromosome:Gm08
Start:13213827
stop:13215293
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G64830AT Annotation by Michelle Graham. TAIR10: Eukaryotic aspartyl protease family protein | chr1:24091271-24092566 REVERSE LENGTH=431 SoyBaseE_val: 6.00E-13ISS
GO:0006508GO-bp Annotation by Michelle Graham. GO Biological Process: proteolysis SoyBaseN/AISS
GO:0005576GO-cc Annotation by Michelle Graham. GO Cellular Compartment: extracellular region SoyBaseN/AISS
GO:0004190GO-mf Annotation by Michelle Graham. GO Molecular Function: aspartic-type endopeptidase activity SoyBaseN/AISS
UniRef100_C6T5F3UniRef Annotation by Michelle Graham. Best UniRef hit: Putative uncharacterized protein n=1 Tax=Glycine max RepID=C6T5F3_SOYBN SoyBaseE_val: 9.00E-63ISS
UniRef100_G1FTR5UniRef Annotation by Michelle Graham. Most informative UniRef hit: Nodulin 41 n=1 Tax=Phaseolus vulgaris RepID=G1FTR5_PHAVU SoyBaseE_val: 8.00E-35ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma08g17702 not represented in the dataset

Glyma08g17702 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.08g166600 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma08g17702.1   sequence type=CDS   gene model=Glyma08g17702   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCATCCACTCTTGTTCTTGTCTTTAGCCTTATACTCACTTTCTTCTATATCCTCTGGAGAAGCCAATGAAAGCCTAAGGGGCTTCAGCATCGACCTTATTCATCGCGACTCACCATTGTCACCCTTTTACAACTCTTCACTCACCCCATCAGAGCGCATCACAAACGCTGCCTTGCGCTCCATTTCTCGATTAAACCGAGTATCAAACTTTTTAGATGAAAACAGACTACCCGAATCTCTTCTAATCCTAGACAAGGTTGAATACCTGTTTACACTGGAATTTGGTAAACAACCGCTAGTCTAA

>Glyma08g17702.1   sequence type=predicted peptide   gene model=Glyma08g17702   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MHPLLFLSLALYSLSSISSGEANESLRGFSIDLIHRDSPLSPFYNSSLTPSERITNAALRSISRLNRVSNFLDENRLPESLLILDKVEYLFTLEFGKQPLV*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo