Glyma08g17702 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma08g17702

Feature Type:	gene_model
Chromosome:	Gm08
Start:	13213827
stop:	13215293
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma08g17702

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G64830	AT	Annotation by Michelle Graham. TAIR10: Eukaryotic aspartyl protease family protein \| chr1:24091271-24092566 REVERSE LENGTH=431	SoyBase	E_val: 6.00E-13	ISS
GO:0006508	GO-bp	Annotation by Michelle Graham. GO Biological Process: proteolysis	SoyBase	N/A	ISS
GO:0005576	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: extracellular region	SoyBase	N/A	ISS
GO:0004190	GO-mf	Annotation by Michelle Graham. GO Molecular Function: aspartic-type endopeptidase activity	SoyBase	N/A	ISS
UniRef100_C6T5F3	UniRef	Annotation by Michelle Graham. Best UniRef hit: Putative uncharacterized protein n=1 Tax=Glycine max RepID=C6T5F3_SOYBN	SoyBase	E_val: 9.00E-63	ISS
UniRef100_G1FTR5	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Nodulin 41 n=1 Tax=Phaseolus vulgaris RepID=G1FTR5_PHAVU	SoyBase	E_val: 8.00E-35	ISS

Expression Patterns of Glyma08g17702

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma08g17702 not represented in the dataset	Glyma08g17702 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma08g17702 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.08g166600	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma08g17702

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma08g17702

Limit To All Plant Sequences

>Glyma08g17702.1   sequence type=CDS   gene model=Glyma08g17702   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCATCCACTCTTGTTCTTGTCTTTAGCCTTATACTCACTTTCTTCTATATCCTCTGGAGAAGCCAATGAAAGCCTAAGGGGCTTCAGCATCGACCTTATTCATCGCGACTCACCATTGTCACCCTTTTACAACTCTTCACTCACCCCATCAGAGCGCATCACAAACGCTGCCTTGCGCTCCATTTCTCGATTAAACCGAGTATCAAACTTTTTAGATGAAAACAGACTACCCGAATCTCTTCTAATCCTAGACAAGGTTGAATACCTGTTTACACTGGAATTTGGTAAACAACCGCTAGTCTAA

Predicted protein sequences of Glyma08g17702

Limit To All Plant Sequences

>Glyma08g17702.1   sequence type=predicted peptide   gene model=Glyma08g17702   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MHPLLFLSLALYSLSSISSGEANESLRGFSIDLIHRDSPLSPFYNSSLTPSERITNAALRSISRLNRVSNFLDENRLPESLLILDKVEYLFTLEFGKQPLV*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain