|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT1G64830 | AT | Annotation by Michelle Graham. TAIR10: Eukaryotic aspartyl protease family protein | chr1:24091271-24092566 REVERSE LENGTH=431 | SoyBase | E_val: 6.00E-13 | ISS |
| GO:0006508 | GO-bp | Annotation by Michelle Graham. GO Biological Process: proteolysis | SoyBase | N/A | ISS |
| GO:0005576 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: extracellular region | SoyBase | N/A | ISS |
| GO:0004190 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: aspartic-type endopeptidase activity | SoyBase | N/A | ISS |
| UniRef100_C6T5F3 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Putative uncharacterized protein n=1 Tax=Glycine max RepID=C6T5F3_SOYBN | SoyBase | E_val: 9.00E-63 | ISS |
| UniRef100_G1FTR5 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Nodulin 41 n=1 Tax=Phaseolus vulgaris RepID=G1FTR5_PHAVU | SoyBase | E_val: 8.00E-35 | ISS |
|
Glyma08g17702 not represented in the dataset |
Glyma08g17702 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma.08g166600 | Wm82.a2.v1 | IGC | As supplied by JGI |
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma08g17702.1 sequence type=CDS gene model=Glyma08g17702 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGCATCCACTCTTGTTCTTGTCTTTAGCCTTATACTCACTTTCTTCTATATCCTCTGGAGAAGCCAATGAAAGCCTAAGGGGCTTCAGCATCGACCTTATTCATCGCGACTCACCATTGTCACCCTTTTACAACTCTTCACTCACCCCATCAGAGCGCATCACAAACGCTGCCTTGCGCTCCATTTCTCGATTAAACCGAGTATCAAACTTTTTAGATGAAAACAGACTACCCGAATCTCTTCTAATCCTAGACAAGGTTGAATACCTGTTTACACTGGAATTTGGTAAACAACCGCTAGTCTAA
>Glyma08g17702.1 sequence type=predicted peptide gene model=Glyma08g17702 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MHPLLFLSLALYSLSSISSGEANESLRGFSIDLIHRDSPLSPFYNSSLTPSERITNAALRSISRLNRVSNFLDENRLPESLLILDKVEYLFTLEFGKQPLV*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||