|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| PF00304 | PFAM | Gamma-thionin family | JGI | ISS | |
| UniRef100_C9E1C1 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Defensin n=1 Tax=Triticum aestivum RepID=C9E1C1_WHEAT | SoyBase | E_val: 4.00E-06 | ISS |
| UniRef100_C9E1C1 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Defensin n=1 Tax=Triticum aestivum RepID=C9E1C1_WHEAT | SoyBase | E_val: 4.00E-06 | ISS |
|
Glyma08g17585 not represented in the dataset |
Glyma08g17585 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma.08g165000 | Wm82.a2.v1 | IGC | As supplied by JGI |
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma08g17585.1 sequence type=CDS gene model=Glyma08g17585 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGGCAAAACAAATTTACGCGTCAATTTTGTTCATCGTTCTCTTTTTTGCTCAAGAAATGTCGATACAAGTTGCGACATCAAAATGCATACCCGAAAATAAAAATTTCCTAGGCCCATGCACCTCTAACCTAGTTTGTCTTCAAATTTGTCAAACACAAGGTTTTGATGATGGAGAATGCAATATGACAAATCTTCATTGTACTTGCCTTAAAAGATGCTCCGTGTCGAAGAATGTTCACTTGGGTGAAGAGGAGGCTCCGGTCAAGACCTCATCCATGAAAGAATAA
>Glyma08g17585.1 sequence type=predicted peptide gene model=Glyma08g17585 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MAKQIYASILFIVLFFAQEMSIQVATSKCIPENKNFLGPCTSNLVCLQICQTQGFDDGECNMTNLHCTCLKRCSVSKNVHLGEEEAPVKTSSMKE*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||