Glyma08g17585 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma08g17585

Feature Type:	gene_model
Chromosome:	Gm08
Start:	13077164
stop:	13077638
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma08g17585

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
PF00304	PFAM	Gamma-thionin family	JGI		ISS
UniRef100_C9E1C1	UniRef	Annotation by Michelle Graham. Best UniRef hit: Defensin n=1 Tax=Triticum aestivum RepID=C9E1C1_WHEAT	SoyBase	E_val: 4.00E-06	ISS
UniRef100_C9E1C1	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Defensin n=1 Tax=Triticum aestivum RepID=C9E1C1_WHEAT	SoyBase	E_val: 4.00E-06	ISS

Expression Patterns of Glyma08g17585

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma08g17585 not represented in the dataset	Glyma08g17585 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma08g17585 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.08g165000	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma08g17585

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma08g17585

Limit To All Plant Sequences

>Glyma08g17585.1   sequence type=CDS   gene model=Glyma08g17585   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCAAAACAAATTTACGCGTCAATTTTGTTCATCGTTCTCTTTTTTGCTCAAGAAATGTCGATACAAGTTGCGACATCAAAATGCATACCCGAAAATAAAAATTTCCTAGGCCCATGCACCTCTAACCTAGTTTGTCTTCAAATTTGTCAAACACAAGGTTTTGATGATGGAGAATGCAATATGACAAATCTTCATTGTACTTGCCTTAAAAGATGCTCCGTGTCGAAGAATGTTCACTTGGGTGAAGAGGAGGCTCCGGTCAAGACCTCATCCATGAAAGAATAA

Predicted protein sequences of Glyma08g17585

Limit To All Plant Sequences

>Glyma08g17585.1   sequence type=predicted peptide   gene model=Glyma08g17585   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAKQIYASILFIVLFFAQEMSIQVATSKCIPENKNFLGPCTSNLVCLQICQTQGFDDGECNMTNLHCTCLKRCSVSKNVHLGEEEAPVKTSSMKE*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain